Sequence of DPV Moroccan pepper virus

Moroccan pepper virus isolate MPV-G coat protein gene, complete cds.

ACC No: JN871220

Dated: 2011-12-22 | Length: 1176 | CRC: 149894704

                
ID   JN871220; SV 1; linear; genomic RNA; STD; VRL; 1176 BP.
XX
AC   JN871220;
XX
DT   22-DEC-2011 (Rel. 111, Created)
DT   22-DEC-2011 (Rel. 111, Last updated, Version 1)
XX
DE   Moroccan pepper virus isolate MPV-G coat protein gene, complete cds.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1176
RA   Alemzadeh E., Izadpanah K.;
RT   "Identification of Pelargonium leaf curl virus and Moroccan pepper virus
RT   into natural host plants in Iran";
RL   Unpublished.
XX
RN   [2]
RP   1-1176
RA   Alemzadeh E., Izadpanah K.;
RT   ;
RL   Submitted (19-OCT-2011) to the INSDC.
RL   Plant Virology Research Center, Virology, Bajgah, Shiraz, Bajgah 0098 711,
RL   Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1176
FT                   /organism="Moroccan pepper virus"
FT                   /host="Gaillardia grandiflora"
FT                   /isolate="MPV-G"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collected_by="Alemzadeh, E"
FT                   /collection_date="10-Apr-2009"
FT                   /identified_by="Alemzadeh, E., Izadpanah, K."
FT                   /db_xref="taxon:208086"
FT   CDS             1. .1176
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AEW27316.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKAQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYSFNNI
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFTSYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGLTTGPSYLTVSSTATVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
XX
SQ   Sequence 1176 BP; 297 A; 278 C; 290 G; 311 T; 0 other;

jn871220 Length: 1176  22-DEC-2011  Type: N  Check: 1425  ..

       1  atggcaatgg tagtaagaaa caacaacaca gctttagtac cgtatagtgg
      51  aggcaaacgt ggcctccaga aagcatttgg atttggagct acaatcgtcg
     101  ggcaaaagat ttatgataat cgcggtaaga ttgtaggttt tatggtagaa
     151  caaggaaaga aaggtttaag taagatggct aatgctctag gttacggcaa
     201  tggtcagaaa gctcagaatc tggttggtgg gatgggtggg gccatcatgg
     251  ctcccgttgc ggtctcaagg cagcttcgcg gaagtaaacc tcggtttact
     301  ggacgtacag ctggctctgt gaccgtcacc caccgtgagt atgtacgaca
     351  ggtaaacaac acatctgcct tcacagtcaa tgggggtatt gtcgggaatc
     401  tgtatcaact gaaccctttg aacggtaccc tgttcacttg gttgccctcc
     451  atagcatcca attttgatca gtactcgttc aataacatca cgttgcacta
     501  tgtccccctc tgtagtacca ctgaggtagg tcgtgttgga ttatatcatg
     551  acaaagactc acaggatcct gagcccactg ataggcagga gttggcgaac
     601  tttagcaccc tcaaagagac acccccctgg ggtgaagtaa tgttgcgaat
     651  acccactgat aggatcaaga ggtactgcga tgacagtaac gcagtcgatc
     701  acaagctaat tgatttgggt caagtaggca ttgccacata tgggggcgct
     751  ggcgctaacg ctgtaggtga tgtgtttaca tcgtatagta ttactttatt
     801  ctcacctcag cccactagct cattgcttag tacaagacaa cagagccttc
     851  tcggtgccac tggtctcacg actgggccga gttacttgac ggtatccagt
     901  acggcgaccg ttctcacctt gacgtttaga gccactggca cttttatggt
     951  ctccggtcac ttccgtgaca ctggagctgc cgtattaggt cttgccggca
    1001  atatcaatgt aaattcactg acagttttgg atacggttgg cctggccacc
    1051  tcgttttcca tcaattgctc agtgtctgct ttaccgtcta ccattacctt
    1101  tacctccaca gcaataacat cttccacggt acactgtgta cgggccgtaa
    1151  gggccaatga tgccacattg ttgtaa