Sequence of DPV Citrus tristeza virus

Citrus tristeza virus capsid protein, p18, p13, and p20 genes, complete cds.

ACC No: JN974902

Dated: 2012-08-06 | Length: 2158 | CRC: 1090820957

                
ID   JN974902; SV 1; linear; genomic RNA; STD; VRL; 2158 BP.
XX
AC   JN974902;
XX
DT   06-AUG-2012 (Rel. 113, Created)
DT   06-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus capsid protein, p18, p13, and p20 genes, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-2158
RA   Singh J.K., Tarafdar A., Sharma S.K., Biswas K.K.;
RT   "Occurrence and biological and molecular characterization of Citrus
RT   tristeza virus in Uttarakhand Terai area of Northern Himalayan hill region
RT   of India";
RL   Unpublished.
XX
RN   [2]
RP   1-2158
RA   Singh J.K., Tarafdar A., Sharma S.K., Biswas K.K.;
RT   ;
RL   Submitted (31-OCT-2011) to the INSDC.
RL   Plant Virology Unit, Division of Plant Pathology, Indian Agricultural
RL   Research Institute, Pusa Campus, New Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2158
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia cv. Pant lemon"
FT                   /isolate="Pant4"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Uttarakhand, Pantnagar"
FT                   /collected_by="Kajal K Biswas"
FT                   /collection_date="2010"
FT                   /identified_by="Kajal K Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /note="p25"
FT                   /protein_id="AFP25726.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             638. .1141
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AFP25727.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDHLEGMNPLAHLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSVWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             1175. .1534
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AFP25728.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NISYAKKCYDLANFDLDFLRVVVIPLSGSTANESRADRANISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCGN"
FT   CDS             1610. .2158
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AFP25729.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLYDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 2158 BP; 591 A; 405 C; 504 G; 658 T; 0 other;

jn974902 Length: 2158  06-AUG-2012  Type: N  Check: 6944  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcagttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacatt gctatgatgt
     251  tatatcgttt agcagttaag agttcatcgt tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaac tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agatctaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagctaa agagcaatta
     601  ttgaaaaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt gatctattgc gttctgattc ccggtttcta
     701  tcgggatggt ggagtttcat tgttaacgtg ggtgacataa tcgtccggtt
     751  tgcgttacat gttcctagtg aagatgtgct gaatagtttt tcggctatat
     801  cgaattgcac aatcatagca gacggtagtg ccttactaaa agacaacacc
     851  gtcgttgacc atttagaagg catgaaccct ttggctcatt tgttaaaatt
     901  agcgaaaacg actactacta tttgttttac tatgtctaat aaggttcttt
     951  ttggtactac taaatccgaa ccacttagtt gtttagctat tacatcggat
    1001  cgagttttat tcaaagttat tatgggtact aacgttgatg attctcgatg
    1051  cggctgcagt gtttggtttt acaacaatgg gacgtttcaa aacgggttga
    1101  cccgttgtaa caatctcgtc gctttgttca gcgcgactta gacacgaagt
    1151  ggccgttagg atttaattgc tgcaatgagt attcgacgtg tgtggttaaa
    1201  ggttgtggct gtaattacgg tattatggta cggtaaagaa ccttctatta
    1251  gtgaaggtta caacgctctt atgaatgatg actttaagtt tatcgacacg
    1301  catttttcaa acatttctta tgctaagaaa tgttacgatt tggctaattt
    1351  cgatttagac tttctacgcg tcgttgtcat tcctttaagt ggtagtacgg
    1401  cgaatgaatc gcgtgctgat cgcgctaata tttcagaaat tgtcgaatcg
    1451  catgtaagcg accgagacag aatgaacatt ttgttgcgta acaagcggat
    1501  ccaaatccca tcgctcttac cttgcggtaa ctagagtcta ctcagtagta
    1551  catctactag tataacgtat tgaacacttt agtaaagagt tttgtttaaa
    1601  ccaaacaata tgcgagctta ctttagtgtt aacgattaca taagcctttt
    1651  ggctaaggtc ggcgcagttg tggaacgttt gtacgatccc agcgtaactc
    1701  tcacggaagt gatggacgaa attaatgatt ttaactcgtt tctcgcttta
    1751  gtacactcta tgaagtcaga catgaacggt gatcatcagg atggtcacca
    1801  tgagatgggt gaacacaagt ctcgattgtt gtgcaatata gaggcgaaac
    1851  tgcgaatact tctcgacatc ataagacgtc ggtttactcg cgacaagctg
    1901  ctctgtacca gcgcaacaga cgtcatgggc ttcttcgtta tgaggtatat
    1951  ggcttccagt cacaccagtt ttgaatccgt aatgcgaacg gagctgaaat
    2001  tagtagttaa agcagtacta tcggatttat cccgcgcgca taaactagat
    2051  tttagcgagc gagcctttgc ggcttacggt atccttttac aaaagggtac
    2101  tgtagcgacc gtttgtggtc agtttgacat taatttagtt tctccatctt
    2151  gcgtgtag