Sequence of DPV Xanthophyllomyces dendrorhous virus L1A

Xanthophyllomyces dendrorhous virus L1A capsid protein (CP) and RNA-dependent RNA polymerase (RdRp) genes, complete cds.

ACC No: JN997472

Dated: 2012-10-02 | Length: 4655 | CRC: 1215458293

                
ID   JN997472; SV 1; linear; genomic RNA; STD; VRL; 4655 BP.
XX
AC   JN997472;
XX
DT   11-APR-2012 (Rel. 112, Created)
DT   02-OCT-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Xanthophyllomyces dendrorhous virus L1A capsid protein (CP) and
DE   RNA-dependent RNA polymerase (RdRp) genes, complete cds.
XX
KW   .
XX
OS   Xanthophyllomyces dendrorhous virus L1A
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-4655
RX   PUBMED; 22838956.
RA   Baeza M., Bravo N., Sanhueza M., Flores O., Villarreal P., Cifuentes V.;
RT   "Molecular characterization of totiviruses in Xanthophyllomyces
RT   dendrorhous";
RL   Virol J 9(1):140-140(2012).
XX
RN   [2]
RP   1-4655
RA   Baeza M., Bravo N., Sanhueza M., Flores O., Villarreal P., Cifuentes V.;
RT   ;
RL   Submitted (04-NOV-2011) to the INSDC.
RL   Ciencias Ecologicas, Universidad de chile, Las Palmeras 3425, Nunoa,
RL   Santiago, Metropolitana 123131231, Chile
XX
DR   EuropePMC; PMC3561658; 22838956.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4655
FT                   /organism="Xanthophyllomyces dendrorhous virus L1A"
FT                   /host="Xanthophyllomyces dendrorhous"
FT                   /mol_type="genomic RNA"
FT                   /note="acronym: XdV-L1A"
FT                   /db_xref="taxon:1167690"
FT   gene            32. .2077
FT                   /gene="CP"
FT   CDS             32. .2077
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="capsid protein"
FT                   /note="XdVL1Agp1"
FT                   /db_xref="InterPro:IPR015302"
FT                   /db_xref="UniProtKB/TrEMBL:H9XW59"
FT                   /protein_id="AFH09411.1"
FT                   /translation="MHTKFIESIVKTDYEGSFQPLFKDGRFTLINKQTAMVDMLGRQYD
FT                   VNSELASNFNVCGKKPEVLHNVGEADFSGLNRKYFDDTNTYSPLAAINEFTKFVPGVRL
FT                   TKGEVDAFAKSQIYEDSQEAYILNMLISWFKALLYEDTNSKDNVLHVKQSGYQDSHVKA
FT                   EYGGVTGDVVHEINMGPPVDDMPEVMMMVRSKDNYWDRPYVLRFDNRSSAQYTFYITHC
FT                   FGRDGTSPLNVDIHIPSVDFDQMLFEPASGAMRSITDPAALPWCKSGTLFGWIKDYVTL
FT                   NRVERAFSAAFETLTAIAFTPMPSYQESLVWDKAITQVVIAKFAPCRAKIPSNLEGEAM
FT                   VTDMDAHDFVLDETKTPRKALFSGAMINYLAFMGLHAILSNYASRHENWRSAFLHSHEE
FT                   LAILHDRTVRAALTSVITGKEMVTFMNPNLFVSYDVTPMVNVSKVSFEEVLERGYPSSL
FT                   PVHGVVPMVSGSLFLSANASDVASQCHLEQGMKVTVDEYGTVSPEDALRVAQMYRMFGH
FT                   ELEIRSEKTEEIHELFAPVQECVIYPSALLYNTRDTDRLKLVSSLRRPGRSSTIPDVSA
FT                   LTAGQTITIDYTIPRIGMHYFNKRVLPIAPSMVLPQRKREITFRVKGHTVLHKVKMNAS
FT                   NVTRPVKDFHGGEIQVAPLLPVLRNARVPIQVNQTSEEDVTAEDVE"
FT   gene            2311. .4596
FT                   /gene="RdRp"
FT   CDS             2311. .4596
FT                   /codon_start=1
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="XdVL1Agp2"
FT                   /db_xref="GOA:H9XW60"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:H9XW60"
FT                   /protein_id="AFH09412.1"
FT                   /translation="MDRESSNKFGIFEASKSVYGVTMSGLVIANGKAKFFFASIKQYLL
FT                   TQSKAMLIAMTRHFSSLYESYAYDDPTSPVNLFRDRFPGRSENEAMTFKQMEELPKSKI
FT                   SGAHHFHFTPMQVLKSIGRGRLERAIQASRLPKDAEMTFATGMLLWYTSISDQMAELIR
FT                   GAGIFKCDSVREYVKEMKQLSVEAKSLQNLVTDDLRTVFELEVLVNRIDGVVDWEKEKE
FT                   NRQSVNVTNIKDSDVFRSACKIFEDAKGIGRRPKSFSWESYWANRWQWSAAGSIHSQYP
FT                   RDMEYVIRDQQSLKNKFITISNMPKCTVDYFSDREPQVQGWSSTKYEWGKQRAIYGTDL
FT                   TSYVLSNFAFYNCENVLPNQFPVGRDANDENVVNRVSGVLNNRMPFCLDFEDFNSQHSS
FT                   GNMKAVIYAYIETFIDCLTPEQEQAAMWTAASLDKQIINDNVGTKTTYESKGTLLSGWR
FT                   LTTFMNSVLNYIYTTKLAAEEKRPGDSLHNGDDVLIGVRSMALPQRCMQNAIKYNVRMQ
FT                   SSKCAVGAIAEFLRIDHKQGGNGQYLSRAVATMVHSRIESRVSTDIRDLVQSMENRFAD
FT                   AKGRGMANDIISGLREQYYMRQSVLCDTDVEDIYLIKNAHRVVGGISEEKDSKMGVLIT
FT                   SQLRAQKNVSIPYLPGVNEYANEIHKALKINVSIKTICDRLYDATYEAVSIKDRKMKIL
FT                   RENRDQWFVNVRRIYKAHKGSQLSQNYGKAALVGFALEVLGREMPDATITTILNTSQRP
FT                   LDLIKHIL"
XX
SQ   Sequence 4655 BP; 1498 A; 956 C; 1125 G; 1076 T; 0 other;

jn997472 Length: 4655  02-OCT-2012  Type: N  Check: 73  ..

       1  gaaaattttt caaacacaga gattccccgt aatgcacact aaattcattg
      51  aaagtattgt taagacagac tacgagggat ctttccagcc tttgttcaag
     101  gacggcagat tcactctgat caacaaacag actgcaatgg tagacatgtt
     151  gggaagacaa tatgatgtca actctgagtt agcttcgaac ttcaacgtgt
     201  gtggtaaaaa accagaagtt ttacacaacg ttggtgaagc ggatttttcg
     251  ggactcaaca ggaagtactt tgatgacacc aatacctact ctccgttggc
     301  agccataaac gagttcacta aattcgtccc tggtgtaaga cttactaagg
     351  gcgaagtgga cgcttttgca aaaagtcaaa tctatgagga ctcccaagag
     401  gcgtacatct tgaatatgct tatttcgtgg tttaaagctc tgttgtatga
     451  ggacactaac tctaaagaca atgtactgca cgtgaagcaa agcggatacc
     501  aagactcgca cgtcaaagcg gaatatggag gtgtaaccgg agatgttgtc
     551  cacgaaataa acatggggcc tccggttgat gacatgcccg aagtaatgat
     601  gatggtgaga agtaaggaca attattggga cagaccatac gtgctaagat
     651  tcgataatag gtcttcggct caatacactt tctacataac tcattgtttt
     701  ggcagggatg gcacatctcc gcttaacgtg gacattcaca taccgagtgt
     751  agacttcgac cagatgttat tcgaaccagc ttccggggct atgagatcaa
     801  tcaccgaccc ggcggcactc ccttggtgca aatccggcac cttattcggc
     851  tggatcaaag actacgttac tcttaacaga gtagaacggg cctttagtgc
     901  agcatttgag actttgactg ctatagcatt cactccaatg ccatcttatc
     951  aagagagttt ggtgtgggac aaagcgataa cgcaagtcgt gattgcaaaa
    1001  tttgctccgt gtagagctaa aataccttct aacctggaag gtgaggctat
    1051  ggtgacagac atggatgcgc acgatttcgt actggacgag actaaaactc
    1101  ccaggaaagc actgttttct ggagccatga ttaactatct agcttttatg
    1151  ggcctacatg cgatactttc aaattacgct tctaggcacg aaaattggag
    1201  atcagccttt ttacacagcc acgaagaact tgctatactt cacgatagga
    1251  ccgtaagggc tgcattaacc agtgtcataa ctggcaaaga aatggttact
    1301  ttcatgaacc caaatctctt tgtatcttat gatgttactc cgatggtcaa
    1351  cgtaagtaaa gtaagcttcg aagaagtgtt agagagggga tacccgtcat
    1401  ctttgcccgt acacggcgtg gtgccaatgg tgtcaggatc cctcttcttg
    1451  tccgctaacg catcagacgt tgcctcacag tgtcaccttg aacagggcat
    1501  gaaggtcacg gtagatgaat atggcactgt gagcccagaa gatgcgctta
    1551  gggtggctca aatgtataga atgtttggtc acgaacttga aataagatcg
    1601  gaaaagactg aggaaataca tgaactgttc gctccggtgc aagagtgcgt
    1651  catttaccct tcggcactac tttacaacac gagggacaca gatagattaa
    1701  agctagtgtc gtcactgcgg agacctggcc gcagtagcac tataccagac
    1751  gtttcggctc tgaccgctgg acaaacaatc accatcgatt acacgatacc
    1801  taggataggc atgcactact tcaacaaaag ggtgctcccc atagctccgt
    1851  caatggtatt acctcaaagg aaaagggaaa taacgttcag ggtcaaaggc
    1901  catacagttc tccataaggt caaaatgaac gcttcaaacg tgacaagacc
    1951  tgtgaaggat tttcacggag gcgaaataca ggtggcacct ttgttgccag
    2001  ttctaaggaa tgctcgtgtg ccaatccaag tcaatcagac ttcggaggag
    2051  gacgtaactg ccgaagatgt agagtagaga actataaaaa ctccaaatac
    2101  acgggaactg acacatcgga ctatctatcg caatacggac aactatataa
    2151  caggaattca ttcatagggc ttaacgtgca gccatgtgaa ggtgaggaaa
    2201  gcacgggcaa cagatgggag tttgccgaca gacaaattcc cttaacgata
    2251  tctctaacaa gccggggaaa cattgaagca gtaccgtttt cagaagctca
    2301  gtatgccttc ctggaccggg aaagctcaaa taaattcggc atattcgagg
    2351  caagtaaaag cgtgtatggg gtaacaatgt ctgggttggt gatagctaat
    2401  ggtaaggcta aatttttctt cgcctcaatc aagcaatatt tgctaaccca
    2451  atctaaagca atgttaatag ccatgaccag acacttctct agcctgtacg
    2501  agagctacgc ttatgatgat cctacgtcac cggtaaacct attcagagac
    2551  agattccccg gtagaagcga aaatgaagcg atgacattca agcaaatgga
    2601  ggagctgccg aagtctaaaa tttcaggagc gcaccatttt cacttcacac
    2651  ctatgcaagt gctgaaatcg atagggagag ggagactgga aagggcgatc
    2701  caggcatcac ggctaccaaa ggacgccgaa atgacgtttg ccacagggat
    2751  gctactgtgg tacacatcta ttagtgatca gatggcagaa ctaatcagag
    2801  gcgcgggaat attcaagtgt gatagtgtga gggaatacgt aaaagaaatg
    2851  aaacagctat cagtggaggc gaagtcgctg caaaacctcg tgaccgatga
    2901  cctaagaaca gtattcgagt tagaggtgct cgtaaataga atcgacggtg
    2951  tagtagactg ggagaaagag aaggaaaaca gacagtcagt aaacgtgaca
    3001  aacataaagg attcagatgt gtttagatct gcgtgtaaga tatttgaaga
    3051  cgccaaaggt ataggccggc gcccgaagag cttcagttgg gagagctatt
    3101  gggctaacag gtggcaatgg agtgctgcgg gcagcataca ctcacaatat
    3151  cccagagaca tggagtacgt aattagggac caacagtcac ttaaaaacaa
    3201  gtttataact atatccaata tgcccaaatg tacagtagac tacttttcgg
    3251  acagggagcc gcaggtgcaa ggttggtcgt caacgaagta tgaatggggc
    3301  aagcaaagag caatatatgg gacagatctg actagctacg tactgtctaa
    3351  tttcgcgttt tacaattgtg agaacgtact accaaatcaa tttccagtcg
    3401  gacgagatgc caatgacgaa aacgtggtga acagagtttc gggagtgcta
    3451  aataacagaa tgcctttctg tcttgacttt gaggacttca atagtcaaca
    3501  cagctcgggc aacatgaagg ctgtaatata cgcttatatc gagactttca
    3551  tagattgtct tactccggaa caagagcaag cggcaatgtg gaccgcagcg
    3601  tcattagaca aacagataat caatgacaac gttggaacca agactacgta
    3651  tgaatctaaa ggaacgctac tttcggggtg gaggctgacg actttcatga
    3701  acagtgtgtt gaactatatt tatacaacga aattagcagc agaagaaaag
    3751  cgtccgggtg atagcttgca caacggagac gatgtcttaa taggagtgag
    3801  gtcaatggct ctgccgcaga ggtgtatgca aaacgccatt aaatataacg
    3851  tgcgaatgca aagcagcaaa tgcgccgtgg gtgcaattgc agaattcctg
    3901  cggatagacc acaaacaggg aggcaacggc cagtacctat ccagagcagt
    3951  ggccacaatg gtacattcga gaattgaaag tagagtctcg actgacataa
    4001  gagacttagt acaatcaatg gaaaacagat tcgctgacgc aaaaggcaga
    4051  gggatggcga atgacatcat atccggattg cgggaacagt actacatgag
    4101  gcagagtgtg ctgtgtgaca ccgacgtaga ggacatatac ttgataaaga
    4151  atgcgcacag agttgtagga ggaataagcg aagaaaaaga ctcgaaaatg
    4201  ggtgttttga taacatccca acttagagcg cagaagaacg tgtcaatacc
    4251  gtacttgccg ggagtaaatg aatatgcaaa cgaaatacac aaagcattaa
    4301  aaataaatgt gtcaattaag actatatgtg acagattata cgacgctaca
    4351  tacgaagctg tctcaatcaa agatcgcaag atgaaaatct tacgggaaaa
    4401  cagagatcag tggttcgtta acgtacgcag aatatacaaa gcacataagg
    4451  gtagtcaatt gtcacagaat tacggtaaag cagccttagt aggattcgca
    4501  ttggaagtgt tgggcagaga aatgcctgat gcaaccataa caacaatact
    4551  gaatacttca caaaggccac tagacctaat taagcacata ttataaatgt
    4601  gcacaaaaga ccagcagggt ccataacaaa catcctgaat acttcacaaa
    4651  ggcca