Sequence of DPV Xanthophyllomyces dendrorhous virus L2

Xanthophyllomyces dendrorhous virus L2 capsid protein (CP) and RNA-dependent RNA polymerase (RdRp) genes, complete cds.

ACC No: JN997474

Dated: 2013-03-29 | Length: 3666 | CRC: 1273092303

                
ID   JN997474; SV 2; linear; genomic RNA; STD; VRL; 3666 BP.
XX
AC   JN997474;
XX
DT   11-APR-2012 (Rel. 112, Created)
DT   29-MAR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Xanthophyllomyces dendrorhous virus L2 capsid protein (CP) and
DE   RNA-dependent RNA polymerase (RdRp) genes, complete cds.
XX
KW   .
XX
OS   Xanthophyllomyces dendrorhous virus L2
OC   Viruses; dsRNA viruses; Totiviridae; Totivirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3666
RX   PUBMED; 22838956.
RA   Baeza M., Bravo N., Sanhueza M., Flores O., Villarreal P., Cifuentes V.;
RT   "Molecular characterization of totiviruses in Xanthophyllomyces
RT   dendrorhous";
RL   Virol J 9(1):140-140(2012).
XX
RN   [2]
RP   1-3666
RA   Baeza M., Bravo N., Sanhueza M., Flores O., Villarreal P., Cifuentes V.;
RT   ;
RL   Submitted (04-NOV-2011) to the INSDC.
RL   Ciencias Ecologicas, Universidad de Chile, Las Palmeras 3425, Nunoa,
RL   Santiago, Metropolitana 123131231, Chile
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3666
RA   Baeza M., Bravo N., Sanhueza M., Flores O., Villarreal P., Cifuentes V.;
RT   ;
RL   Submitted (28-MAR-2013) to the INSDC.
RL   Ciencias Ecologicas, Universidad de Chile, Las Palmeras 3425, Nunoa,
RL   Santiago, Metropolitana 123131231, Chile
XX
DR   EuropePMC; PMC3561658; 22838956.
XX
CC   On Mar 28, 2013 this sequence version replaced gi:383388875.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3666
FT                   /organism="Xanthophyllomyces dendrorhous virus L2"
FT                   /host="Xanthophyllomyces dendrorhous"
FT                   /mol_type="genomic RNA"
FT                   /note="acronym: XdV-L2"
FT                   /db_xref="taxon:1167692"
FT   gene            71. .1114
FT                   /gene="CP"
FT   CDS             71. .1114
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="capsid protein"
FT                   /note="XdVL2gp1"
FT                   /db_xref="InterPro:IPR015302"
FT                   /db_xref="UniProtKB/TrEMBL:H9XW63"
FT                   /protein_id="AFH09415.2"
FT                   /translation="MEGEAMVTDMDAHDFVLDETKTPRKALFSGAMINYLAFMGLHAIL
FT                   SNYASRHENWRSAFLHSHEELAILHDRTVRAALTSVITGKEMVTFMNPNLFVSYDVTPM
FT                   VNVSKVSFEEVLERGYPSSLPVHGVVPMVSGSLFLSANASDVASQCHLEQGMKVTVDEY
FT                   GTVSPEDALRVAQMYRMFGHELEIRSEKTEEIHELFAPVQECVIYPSALLYNTRDTDRL
FT                   KLVSSLRRPGRSSTIPDVSALTAGQTITIDYTIPRIGMHYFNKRVLPIAPSMVLPQRKR
FT                   EITFRVKGHTVLHKVKMNASNVTRPVKDFHGGEIQVAPLLPVLRNARVPIQVNQTSEED
FT                   VTAEDVE"
FT   gene            1348. .3633
FT                   /gene="RdRp"
FT   CDS             1348. .3633
FT                   /codon_start=1
FT                   /gene="RdRp"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="XdVL2gp2"
FT                   /db_xref="GOA:H9XW64"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:H9XW64"
FT                   /protein_id="AFH09416.2"
FT                   /translation="MDRESSNKFGIFEASKSVYGVTMSGLVIANGKAKFFFASIKQYLL
FT                   TQSKAMLIAMTRHFSSLYESYAYDDPTSPVNLFRDRFPGRSENEAMTFKQMEELPKSKI
FT                   SGAHHFHFTPMQVLKSIGRGRLERAIQASRLPKDAEMTFATGMLLWYTSISDQMAELIR
FT                   GAGIFKCDSVREYVKEMKQLSVEAKSLQNLVTDDLRTVFELEVLVNRIDGVVDWEKEKE
FT                   NRQSINVTNIKDSDVFRSACKIFEDAKGIGRRPKSFSWESYWANRWQWSAAGSIHSQYP
FT                   RDMEYVIRDQQSLKNKFITISNMPKCTVDYFSDREPQVQGWSSTKYEWGKQRAIYGTDL
FT                   TSYVLSNFAFYNCENVLPNQFPVGRDANDENVVNRVSGVLNNRMPFCLDFEDFNSQHSS
FT                   GNMKAVIYAYIETFIDCLTPEQEQAAMWTAASLDKQIINDNVGTKTTYESKGTLLSGWR
FT                   LTTFMNSVLNYIYTTKLAAEEKRPGDSLHNGDDVLIGVRSMALPQRCMQNAIKYNVRMQ
FT                   SSKCAVGAIAEFLRIDHKQGGNGQYLSRAVATMVHSRIESRVSTDIRDLVQSMENRFAD
FT                   AKGRGMANDIISGLREQYYMRQSVLCDTDVEDIYLIKNAHRVVGGISEEKDSKMGVLIT
FT                   SQLRAQKNVSIPYLPGVNEYANEIHKALKINVSIKTICDRLYDATYEAVSIKDRKMKIL
FT                   RENRDQWFVNVRRIYKAHKGSQLSQNYGKAALVGFALEVLGREMPDATITTILNTSQRP
FT                   LDLIKHIL"
XX
SQ   Sequence 3666 BP; 1203 A; 742 C; 901 G; 820 T; 0 other;

jn997474 Length: 3666  29-MAR-2013  Type: N  Check: 4020  ..

       1  gtgggacaaa gcgataacgc aagtcgtgat tgcaaaattt gctccgtgta
      51  gagctaaaat accttctaac ctggaaggtg aggctatggt gacagacatg
     101  gatgcgcacg atttcgtact ggacgagact aaaactccca ggaaagcact
     151  gttttctgga gccatgatta actatctagc ttttatgggc ctacatgcga
     201  tactttcaaa ttacgcttct aggcacgaaa attggagatc agccttttta
     251  cacagccacg aagaacttgc tatacttcac gataggaccg taagggctgc
     301  attaaccagt gtcataactg gcaaagaaat ggttactttc atgaacccaa
     351  atctctttgt atcttatgat gttactccga tggtcaacgt aagtaaagta
     401  agcttcgaag aagtgttaga gaggggatac ccgtcatctt tgcccgtaca
     451  cggcgtggtg ccaatggtgt caggatccct cttcttgtcc gctaacgcat
     501  cagacgttgc ctcacagtgt caccttgaac agggcatgaa ggtcacggta
     551  gatgaatatg gcactgtgag cccagaagat gcgcttaggg tggctcaaat
     601  gtatagaatg tttggtcacg aacttgaaat aagatcggaa aagactgagg
     651  aaatacatga actgttcgct ccggtgcaag agtgcgtcat ttacccttcg
     701  gcactacttt acaacacgag ggacacagat agattaaagc tagtgtcgtc
     751  actgcggaga cctggccgca gtagcactat accagacgtt tcggctctga
     801  ccgctggaca aacaatcacc atcgattaca cgatacctag gataggcatg
     851  cactacttca acaaaagggt gctccccata gctccgtcaa tggtattacc
     901  tcaaaggaaa agggaaataa cgttcagggt caaaggccat acagttctcc
     951  ataaggtcaa aatgaacgct tcaaacgtga caagacctgt gaaggatttt
    1001  cacggaggcg aaatacaggt ggcacctttg ttgccagttc taaggaatgc
    1051  tcgtgtgcca atccaagtca atcagacttc ggaggaggac gtaactgccg
    1101  aagatgtaga gtagagaact ataaaaactc caaatacacg ggaactgaca
    1151  catcggacta tctatcgcaa tacggacaac tatataacag gaattcattc
    1201  atagggctta acgtgcagcc atgtgaaggt gaggaaagca cgggcaacag
    1251  atgggagttt gccgacagac aaattccctt aacgatatct ctaacaagcc
    1301  ggggaaacat tgaagcagta ccgttttcag aagctcagta tgccttcctg
    1351  gaccgggaaa gctcaaataa attcggcata ttcgaggcaa gtaaaagcgt
    1401  gtatggggta acaatgtctg ggttggtgat agctaatggt aaggctaaat
    1451  ttttcttcgc ctcaatcaag caatatttgc taacccaatc taaagcaatg
    1501  ttaatagcca tgaccagaca cttctctagc ctgtacgaga gctacgctta
    1551  tgatgatcct acgtcaccgg taaacctatt cagagacaga ttccccggta
    1601  gaagcgaaaa tgaagcgatg acattcaagc aaatggagga gctgccgaag
    1651  tctaaaattt caggagcgca ccattttcac ttcacaccta tgcaagtgct
    1701  gaaatcgata gggagaggga gactggaaag ggcgatccag gcatcacggc
    1751  taccaaagga cgccgaaatg acgtttgcca cagggatgct actgtggtac
    1801  acatctatta gtgatcagat ggcagaacta atcagaggcg cgggaatatt
    1851  caagtgtgat agtgtgaggg aatacgtaaa agaaatgaaa cagctatcag
    1901  tggaggcgaa gtcgctgcaa aacctcgtga ccgatgacct aagaacagta
    1951  ttcgagttag aggtgctcgt aaatagaatc gacggtgtag tagactggga
    2001  gaaagagaag gaaaacagac agtcaataaa cgtgacaaac ataaaggatt
    2051  cagatgtgtt tagatctgcg tgtaagatat ttgaagacgc caaaggtata
    2101  ggccggcgcc cgaagagctt cagttgggag agctattggg ctaacaggtg
    2151  gcaatggagt gctgcgggca gcatacactc acaatatccc agagacatgg
    2201  agtacgtaat tagggaccaa cagtcactta aaaacaagtt tataactata
    2251  tccaatatgc ccaaatgtac agtagactac ttttcggaca gggagccgca
    2301  ggtgcaaggt tggtcgtcaa cgaagtatga atggggcaag caaagagcaa
    2351  tatatgggac agatctgact agctacgtac tgtctaattt cgcgttttac
    2401  aattgtgaga acgtactacc aaatcaattt ccagtcggac gagatgccaa
    2451  tgacgaaaac gtggtgaaca gagtttcggg agtgctaaat aacagaatgc
    2501  cattctgtct tgactttgag gacttcaata gtcaacacag ctcgggcaac
    2551  atgaaggctg taatatacgc ttatatcgag actttcatag attgtcttac
    2601  tccggaacaa gagcaagcgg caatgtggac cgcagcgtca ttagacaaac
    2651  agataatcaa tgacaacgtt ggaaccaaga ctacgtatga atctaaagga
    2701  acgctacttt cggggtggag gctgacgact ttcatgaaca gtgtgttgaa
    2751  ctatatttat acaacgaaat tagcagcaga agaaaagcgt ccgggtgata
    2801  gcttgcacaa cggagacgat gtcttaatag gagtgaggtc aatggctctg
    2851  ccgcagaggt gtatgcaaaa cgccattaaa tataacgtgc gaatgcaaag
    2901  cagcaaatgc gccgtgggtg caattgcaga attcctgcgg atagaccaca
    2951  aacagggagg caacggccag tacctatcca gagcagtggc cacaatggta
    3001  cattcgagaa ttgaaagtag agtctcgact gacataagag acttagtaca
    3051  atcaatggaa aacagattcg ctgacgcaaa aggcagaggg atggcgaatg
    3101  acatcatatc cggattgcgg gaacagtact acatgaggca gagtgtgctg
    3151  tgtgacaccg acgtagagga catatacttg ataaagaatg cgcacagagt
    3201  tgtaggagga ataagcgaag aaaaagactc gaaaatgggt gttttgataa
    3251  catcccaact tagagcgcag aagaacgtgt caataccgta cttgccggga
    3301  gtaaatgaat atgcaaacga aatacacaaa gcattaaaaa taaatgtgtc
    3351  aattaagact atatgtgaca gattatacga cgctacatac gaagctgtct
    3401  caatcaaaga tcgcaagatg aaaatcttac gggaaaacag agatcagtgg
    3451  ttcgttaacg tacgcagaat atacaaagca cataagggta gtcaattgtc
    3501  acagaattac ggtaaagcag ccttagtagg attcgcattg gaagtgttgg
    3551  gcagagaaat gcctgatgca accataacaa caatactgaa tacttcacaa
    3601  aggccactag acctaattaa gcacatatta taaatgtgca caaaagacca
    3651  gcagggtcca taacaa