Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate JY-5 coat protein (p25) gene, complete cds.

ACC No: JQ039908

Dated: 2012-03-20 | Length: 672 | CRC: -1712359092

                
ID   JQ039908; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JQ039908;
XX
DT   20-MAR-2012 (Rel. 112, Created)
DT   20-MAR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate JY-5 coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Yi L., Lu Z.J., Lai X.H., Ma G.H.;
RT   "Influence of Newhall Navel Orange on Composition of Citrus Tristeza Virus
RT   Isolates Collected from Jianyang Tangelo";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Yi L., Lu Z.J., Lai X.H., Ma G.H.;
RT   ;
RL   Submitted (16-NOV-2011) to the INSDC.
RL   School of Life and Environmental Science, GanNan Normal University,
RL   Economic Development Zone, Ganzhou, Jiangxi 341000, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Jianyang tangelo"
FT                   /isolate="JY-5"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AFD28559.1"
FT                   /translation="MDDETKKLKNKNKEAREGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 127 C; 176 G; 178 T; 0 other;

jq039908 Length: 672  20-MAR-2012  Type: N  Check: 1220  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aggcgagaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacaa
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga