Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate JY-5 p23 (p23) gene, complete cds.

ACC No: JQ039912

Dated: 2012-03-20 | Length: 630 | CRC: -625312769

                
ID   JQ039912; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   JQ039912;
XX
DT   20-MAR-2012 (Rel. 112, Created)
DT   20-MAR-2012 (Rel. 112, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate JY-5 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Yi L., Lu Z.J., Lai X.H., Ma G.H.;
RT   "Influence of Newhall Navel Orange on Composition of Citrus Tristeza Virus
RT   Isolates Collected from Jianyang Tangelo";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Yi L., Lu Z.J., Lai X.H., Ma G.H.;
RT   ;
RL   Submitted (17-NOV-2011) to the INSDC.
RL   School of Life and Environmental Science, GanNan Normal University,
RL   Economic Development Zone, Ganzhou, Jiangxi 341000, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /host="Jianyang tangelo"
FT                   /isolate="JY-5"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   gene            1. .630
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /protein_id="AFD28563.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 196 A; 124 C; 157 G; 153 T; 0 other;

jq039912 Length: 630  20-MAR-2012  Type: N  Check: 7524  ..

       1  atggacgata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacacg gctagtactg aaatcaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcaagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagaa atgtttgcga tcgatttggt tatgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttcaggc
     601  ggagttctcc gtgaacacca cttcatctga