Sequence of DPV Olive mild mosaic virus

Olive mild mosaic virus RNA-dependent RNA polymerase and p23 genes, partial cds; p52, p8, and p6 genes, complete cds; and coat protein gene, partial cds.

ACC No: JQ288895

Dated: 2012-07-27 | Length: 3012 | CRC: -1585375443

                
ID   JQ288895; SV 1; linear; genomic RNA; STD; VRL; 3012 BP.
XX
AC   JQ288895;
XX
DT   01-APR-2012 (Rel. 112, Created)
DT   27-JUL-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Olive mild mosaic virus RNA-dependent RNA polymerase and p23 genes, partial
DE   cds; p52, p8, and p6 genes, complete cds; and coat protein gene, partial
DE   cds.
XX
KW   .
XX
OS   Olive mild mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus; unclassified Necrovirus.
XX
RN   [1]
RP   1-3012
RA   Gratsia M.E., Kyriakopoulou P.E., Voloudakis A.E., Fasseas C.,
RA   Tzanetakis I.E.;
RT   "First Report of Olive mild mosaic virus and Sowbane mosaic virus in
RT   Spinach in Greece";
RL   Plant Dis. 96(8):1230-1230(2012).
XX
RN   [2]
RP   1-3012
RA   Gratsia M., Tzanetakis I.E.;
RT   ;
RL   Submitted (15-DEC-2011) to the INSDC.
RL   Plant Pathology, University of Arkansas, 495. N. Park Creek Dr.,
RL   Fayetteville, AR 72703, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3012
FT                   /organism="Olive mild mosaic virus"
FT                   /host="Spinacia oleracea cv. Spinaker"
FT                   /mol_type="genomic RNA"
FT                   /country="Greece"
FT                   /collected_by="P.E. Kyriakopoulou"
FT                   /collection_date="2004"
FT                   /db_xref="taxon:295090"
FT   CDS             <1. .1605
FT                   /codon_start=1
FT                   /transl_except=(pos:37. .39,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="read-through stop codon"
FT                   /db_xref="UniProtKB/TrEMBL:H9NET9"
FT                   /protein_id="AFF57920.1"
FT                   /translation="IGSQVGLAFRAKXGCLERRPGFSTSVSRGDHPDLVVKPSGHPEKQ
FT                   RQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFYVEGPNGLQDAPKPDKGAFNSLAKF
FT                   RDLYTKNSWRHSPVTNEQFLMNYSGRKLTIYKEAVDSLSHQPLSLRDARLKTFVKAEKL
FT                   NLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEITVFKGYTLEQQGE
FT                   IMHCKWKKYVNPVAVGLDASRFDQHVSKEALEYEHEFYLRDYPNDKQLKWLLKQQLCNA
FT                   GTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVYGLKDHLGIELSLANNGDDCVI
FT                   VCEKADLLKLTSSIEPYFKKFGFKMEVEKPVDIFERIEICQTQPVFDGTQYIMVRKPSV
FT                   VTSKDVTSLIPCQTQAQYAEWLQAVGECGMSINGGIPVMQNFYTMLQTGVKRTKFTKTG
FT                   EFQTNGLGYHSRYMHRVARTPSPETRLSFYLAFGITPDLQEALEVFYDTSTLELDDVIP
FT                   ADTYQVSGEHLINGLPN"
FT   CDS             <1. .39
FT                   /codon_start=1
FT                   /product="p23"
FT                   /db_xref="UniProtKB/TrEMBL:H9NEU4"
FT                   /protein_id="AFF57925.1"
FT                   /translation="IGSQVGLAFRAK"
FT   CDS             223. .1605
FT                   /codon_start=1
FT                   /product="p52"
FT                   /db_xref="UniProtKB/TrEMBL:H9NEU3"
FT                   /protein_id="AFF57924.1"
FT                   /translation="MERVFYVEGPNGLQDAPKPDKGAFNSLAKFRDLYTKNSWRHSPVT
FT                   NEQFLMNYSGRKLTIYKEAVDSLSHQPLSLRDARLKTFVKAEKLNLSKKPDPAPRVIQP
FT                   RSPRYNVCLGRYLRHYEHHAFKTIAKCFGEITVFKGYTLEQQGEIMHCKWKKYVNPVAV
FT                   GLDASRFDQHVSKEALEYEHEFYLRDYPNDKQLKWLLKQQLCNAGTAFASDGIIKYKKE
FT                   GCRMSGDMNTSLGNCILMCAMVYGLKDHLGIELSLANNGDDCVIVCEKADLLKLTSSIE
FT                   PYFKKFGFKMEVEKPVDIFERIEICQTQPVFDGTQYIMVRKPSVVTSKDVTSLIPCQTQ
FT                   AQYAEWLQAVGECGMSINGGIPVMQNFYTMLQTGVKRTKFTKTGEFQTNGLGYHSRYMH
FT                   RVARTPSPETRLSFYLAFGITPDLQEALEVFYDTSTLELDDVIPADTYQVSGEHLINGL
FT                   PN"
FT   CDS             1589. .1810
FT                   /codon_start=1
FT                   /product="p8"
FT                   /db_xref="UniProtKB/TrEMBL:H9NEU0"
FT                   /protein_id="AFF57921.1"
FT                   /translation="MDYQTDVNEDNVSVSGRARRGTGDKRHNGSGMSGVKRHAVSETAQ
FT                   KSQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             1814. .1984
FT                   /codon_start=1
FT                   /product="p6"
FT                   /db_xref="UniProtKB/TrEMBL:H9NEU1"
FT                   /protein_id="AFF57922.1"
FT                   /translation="MAGCRCCDTSPGITLFPYFAILILILAILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   gap             2006. .2552
FT                   /estimated_length=547
FT   CDS             <2553. .2817
FT                   /codon_start=2
FT                   /product="coat protein"
FT                   /db_xref="UniProtKB/TrEMBL:H9NEU2"
FT                   /protein_id="AFF57923.1"
FT                   /translation="ASAFNSNSSGGESLVSTLDTNRVDKKWYSTIGNAAFTALTSIDKN
FT                   QFCPATALIAGDGGPALATAVGDVFMRYEIEFIEPINPTINV"
XX
SQ   Sequence 3012 BP; 694 A; 564 C; 603 G; 604 T; 547 other;

jq288895 Length: 3012  27-JUL-2012  Type: N  Check: 360  ..

       1  attggatccc aagtcggctt ggcctttcgg gccaaatagg ggtgcctaga
      51  gaggaggcca gggttctcca cgtccgtctc gcgtggagat caccctgatc
     101  tggtggtcaa accatcagga caccccgaga aacagcgcca gttgttgcgc
     151  tatagtggaa ttggcggcca tttattaatc ggcatccaca acaactctct
     201  ttccaatttg cgccggggct taatggaaag agtattttac gtcgaagggc
     251  ccaacggcct ccaagacgcc ccgaaacccg acaagggggc tttcaactcc
     301  cttgctaagt ttagagatct ctatactaaa aatagttggc gtcattcccc
     351  tgtaaccaat gagcaatttt tgatgaatta ctcgggcagg aaactgacta
     401  tttacaagga agcggttgat agtttgtcgc atcaaccact aagcctaaga
     451  gatgctcggc tgaagacatt cgtaaaggcg gaaaaattaa atctgagcaa
     501  aaagccagat ccagcaccga gggtcattca gcctcggtca ccccgctaca
     551  acgtttgttt gggtcgttac cttcgtcatt atgaacacca cgcgttcaaa
     601  accattgcta aatgctttgg ggaaatcacg gtctttaagg gttacactct
     651  cgagcaacaa ggtgagatca tgcactgcaa gtggaagaaa tatgttaatc
     701  ccgtcgcggt cggactcgat gccagtcggt tcgaccaaca cgtgtctaaa
     751  gaagcacttg aatatgagca tgaattttat ttgagagatt atcccaatga
     801  taaacagctc aaatggttgc ttaagcaaca attgtgcaat gccggtacgg
     851  cttttgctag tgatggaatc atcaagtaca agaaggaggg atgtagaatg
     901  agtggagaca tgaacacgag tttgggtaat tgcattttaa tgtgtgccat
     951  ggtctacggg ttgaaggacc acctaggaat cgaattatcg ttagccaata
    1001  atggggatga ctgcgtcatt gtctgtgaga aagcggattt attaaagttg
    1051  acgagcagca tcgaaccata tttcaagaaa ttcggattca agatggaggt
    1101  ggagaaaccc gttgatattt tcgagcgcat tgaaatttgc caaacccagc
    1151  ctgtgttcga tggaacccaa tacatcatgg ttaggaaacc ctctgttgtc
    1201  acgtccaagg acgtcactag tttaatccca tgccaaacac aagcacaata
    1251  tgcagaatgg ctgcaagctg taggtgagtg cggaatgagc atcaatggtg
    1301  gaattcctgt tatgcagaat ttctacacca tgctgcaaac tggcgttaag
    1351  cgcacaaagt tcaccaagac cggcgagttc cagacgaacg ggctggggta
    1401  tcactctcga tatatgcaca gagtggcccg aactccttcg cctgaaaccc
    1451  gtttatcctt ttacctagcg ttcggtatca caccagacct ccaggaagct
    1501  ttggaggtct tctatgatac cagtacgcta gaattggatg atgttatccc
    1551  agctgataca taccaagtat caggagagca tttaatcaat ggattaccaa
    1601  actgatgtta acgaagataa cgtgagcgta agcggtcggg ctaggagagg
    1651  cactggggat aagagacaca atggttcggg aatgtctggc gttaagcgtc
    1701  atgcggtgag tgaaacagct cagaaatcgc agcaaggtac tggcaatggc
    1751  acaatgacca acatagctga agaacagacc attaccgtga catacaactt
    1801  taacttttaa gttatggctg gctgtcgctg ctgtgatact tcaccaggta
    1851  ttacattatt cccttacttt gctatcttaa ttctcatcct tgcaatctta
    1901  gttgttggca ctccaaacca gcaatatcat cattctccta gtacttacga
    1951  gtataagact caacacattt cgatcgccaa gtagacattt actttaacac
    2001  caaaannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2051  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2101  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2151  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2201  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2251  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2301  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2351  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2401  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2451  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2501  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
    2551  nncgcctctg catttaatag taacagctct ggaggggaat cgctagtgtc
    2601  cactttggac accaatcgcg tcgacaagaa atggtacagc accataggaa
    2651  acgcggcatt caccgcgttg acatcaatcg acaagaacca attttgtcca
    2701  gctacggccc tcattgccgg agatggcgga cctgctcttg ccacagctgt
    2751  gggcgatgtt tttatgcggt acgagattga gttcattgaa ccaatcaacc
    2801  ccaccataaa tgtttgagtg ttagttaact ggcttaaacc ctaagggtac
    2851  aaatgtgggc ggtaagcaag agggatcctg ggaaacaggc ttcgacgggc
    2901  tgggggtggt gccccggccg acgcatcact tgctgataca accactagac
    2951  acctatgggc gggtctagcc aggtctccac gccatgatca actggaaacg
    3001  gtgagagggg gg