Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Tapi clone 7 coat protein (p25) gene, complete cds.

ACC No: JQ339727

Dated: 2012-06-01 | Length: 672 | CRC: -1466561356

                
ID   JQ339727; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JQ339727;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   01-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Tapi clone 7 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   "Biological and molecular characterization of Citrus tristeza virus (CTV)
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   ;
RL   Submitted (29-DEC-2011) to the INSDC.
RL   Parco Scientifico e Tecnologico della Sicilia s.c.p.a., ZI Blocco Palma I,
RL   Str.le V. Lancia 57, Catania, Catania 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="sweet orange 'TAPI'"
FT                   /isolate="Tapi"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy:Sicily"
FT                   /clone="7"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AEX56596.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEIVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 128 C; 173 G; 178 T; 0 other;

jq339727 Length: 672  01-JUN-2012  Type: N  Check: 878  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaaatcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga