Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate HU-PSTS clone 53.1 coat protein (p25) gene, complete cds.

ACC No: JQ339732

Dated: 2012-06-01 | Length: 672 | CRC: 592397084

                
ID   JQ339732; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JQ339732;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   01-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate HU-PSTS clone 53.1 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   "Biological and molecular characterization of Citrus tristeza virus (CTV)
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   ;
RL   Submitted (29-DEC-2011) to the INSDC.
RL   Parco Scientifico e Tecnologico della Sicilia s.c.p.a., ZI Blocco Palma I,
RL   Str.le V. Lancia 57, Catania, Catania 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="sweet orange"
FT                   /isolate="HU-PSTS"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /clone="53.1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AEX56601.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEHLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 128 C; 172 G; 181 T; 0 other;

jq339732 Length: 672  01-JUN-2012  Type: N  Check: 4197  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  gggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcattta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga