Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate P60 coat protein (p25) gene, complete cds.

ACC No: JQ339736

Dated: 2012-06-01 | Length: 672 | CRC: -492895526

                
ID   JQ339736; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JQ339736;
XX
DT   01-JUN-2012 (Rel. 113, Created)
DT   01-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate P60 coat protein (p25) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   "Biological and molecular characterization of Citrus tristeza virus (CTV)
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Licciardello G., Raspagliesi D., Catara A.;
RT   ;
RL   Submitted (29-DEC-2011) to the INSDC.
RL   Parco Scientifico e Tecnologico della Sicilia s.c.p.a., ZI Blocco Palma I,
RL   Str.le V. Lancia 57, Catania, Catania 95121, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="sweet orange"
FT                   /isolate="P60"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy:Sicily"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AEX56605.1"
FT                   /translation="MDDKRKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 197 A; 122 C; 170 G; 183 T; 0 other;

jq339736 Length: 672  01-JUN-2012  Type: N  Check: 3445  ..

       1  atggacgaca aacgaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgctg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgagtact
     151  caacagaatg ctgctttgaa cagggactta tttcttgctc tgaaagggaa
     201  gtatcctaac ttgcctgaca aagataagga ctttcacata gctatgatgt
     251  tataccgttt agcggttaag agttcatcat tgcaaagtga tgatgacacc
     301  acgggcataa cgtacactcg ggagggtgtt gaagtagatt tgtctgacaa
     351  actttggacc gacatcgtgt ataattctaa gggtattggt aaccgaacta
     401  acgcccttcg agtctggggt agaactaacg atgctcttta cttagccttt
     451  tgtagacaga accgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt atttgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaaaaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga