Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 04_SR_LEN_NuT_SwO_01 p20 protein gene, complete cds.

ACC No: JQ422293

Dated: 2012-08-07 | Length: 549 | CRC: 486243224

                
ID   JQ422293; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   JQ422293;
XX
DT   07-AUG-2012 (Rel. 113, Created)
DT   07-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 04_SR_LEN_NuT_SwO_01 p20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   "Citrus tristeza virus in Italy: fron an outbreak to a pandemy";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   ;
RL   Submitted (18-JAN-2012) to the INSDC.
RL   DEMETRA, University of Palermo, Viale delle Scienze ed. 4, Palermo, Sicily
RL   90128, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /isolate="04_SR_LEN_NuT_SwO_01"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /collection_date="2004"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /note="forms inclusion bodies and play a role of
FT                   suppressors of RNA silencing"
FT                   /protein_id="AFP33048.1"
FT                   /translation="MRVHFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHGMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLLVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 134 A; 114 C; 140 G; 161 T; 0 other;

jq422293 Length: 549  07-AUG-2012  Type: N  Check: 3495  ..

       1  atgcgagttc actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgggatggg
     201  tgaacacaag tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgatat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag atgtcatggg cttcttcgtt atgaggtaca tgagttctag
     351  tcacactagt ttcgagtccg taatgcgaac ggagctgaaa ttactggtta
     401  aagcggtact gtcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatccttttg caaaagggta ctgtagcgac
     501  cgtttgcggt cagtttgaca ttaatttagt ctctccatct tgcgtgtag