Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 06_CT_MIS_NOV_Man_01 p20 protein gene, complete cds.

ACC No: JQ422315

Dated: 2012-08-07 | Length: 549 | CRC: -1619986045

                
ID   JQ422315; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   JQ422315;
XX
DT   07-AUG-2012 (Rel. 113, Created)
DT   07-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 06_CT_MIS_NOV_Man_01 p20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   "Citrus tristeza virus in Italy: fron an outbreak to a pandemy";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   ;
RL   Submitted (18-JAN-2012) to the INSDC.
RL   DEMETRA, University of Palermo, Viale delle Scienze ed. 4, Palermo, Sicily
RL   90128, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /isolate="06_CT_MIS_NOV_Man_01"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /collection_date="2006"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /note="forms inclusion bodies and play a role of
FT                   suppressors of RNA silencing"
FT                   /protein_id="AFP33070.1"
FT                   /translation="MRAYFSVNDYISLSAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSVTD
FT                   TMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 142 A; 114 C; 134 G; 159 T; 0 other;

jq422315 Length: 549  07-AUG-2012  Type: N  Check: 1354  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt cggctaaggt
      51  cggcgcagtt gtggaacgtt tatgcgatcc aagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct actctgtacc
     301  agcgtaacag ataccatggg cttcttcgtt atgaggtaca tgagttctag
     351  tcacaccagt ttcgagtccg taatgcgaac agagctgaaa ttagtggtta
     401  aagcggtact gtcggatttg tcccgcgcgc ataaactaga ttttagcgaa
     451  cgagcctttg cagcttacgg tatcctttta caaaagggta ctgtagcgac
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag