Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 05_PA_PAL_ET_Man_01 p20 protein gene, complete cds.

ACC No: JQ422350

Dated: 2012-08-07 | Length: 549 | CRC: 1787426193

                
ID   JQ422350; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   JQ422350;
XX
DT   07-AUG-2012 (Rel. 113, Created)
DT   07-AUG-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 05_PA_PAL_ET_Man_01 p20 protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   "Citrus tristeza virus in Italy: fron an outbreak to a pandemy";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Davino S., Panno S., Davino M., Rubio L.;
RT   ;
RL   Submitted (18-JAN-2012) to the INSDC.
RL   DEMETRA, University of Palermo, Viale delle Scienze ed. 4, Palermo, Sicily
RL   90128, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sp."
FT                   /isolate="05_PA_PAL_ET_Man_01"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /collection_date="2005"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /note="forms inclusion bodies and play a role of
FT                   suppressors of RNA silencing"
FT                   /protein_id="AFP33105.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHHHGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERGFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 133 A; 110 C; 142 G; 164 T; 0 other;

jq422350 Length: 549  07-AUG-2012  Type: N  Check: 6357  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  tggttcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcac catggtcacc atgagatggg
     201  tgaacataaa tctcggttgt tgtgcaatat agaggcgaaa ctgcgagtgc
     251  ttctcgacat cataagacgt cggtttactc gcgaaaaact gctctgtacc
     301  agtgctacag atgttgtggg cttcttcgtc gtgaggtaca tgagttctag
     351  tcacactagt ttcgaaaccg taatgcgaac ggaactgaag ttggtggtta
     401  aagctgtgct gtcggaattg tcccgcacgc ataaactaga ttttagcgag
     451  cgagggttta cggcttacgg tatccttttg cagaagggca ccgtggcaac
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag