Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate OR2, complete genome.

ACC No: JQ771955

Dated: 2012-05-11 | Length: 16486 | CRC: -727702303

                
ID   JQ771955; SV 1; linear; genomic RNA; STD; VRL; 16486 BP.
XX
AC   JQ771955;
XX
DT   04-APR-2012 (Rel. 112, Created)
DT   11-MAY-2012 (Rel. 112, Last updated, Version 2)
XX
DE   Grapevine leafroll-associated virus 2 isolate OR2, complete genome.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16486
RX   PUBMED; 22438553.
RA   Kurth E.G., Peremyslov V.V., Prokhnevsky A.I., Kasschau K.D., Miller M.,
RA   Carrington J.C., Dolja V.V.;
RT   "Virus-derived gene expression and RNA interference vector for grapevine";
RL   J. Virol. 86(11):6002-6009(2012).
XX
RN   [2]
RP   1-16486
RA   Kurth E., Peremyslov V., Prokhnevsky A., Kasschau K., Miller M.,
RA   Carrington J., Dolja V.;
RT   ;
RL   Submitted (12-MAR-2012) to the INSDC.
RL   Department of Botany and Plant Pathology, Oregon State University, 2082
RL   Cordley Hall, Corvallis, OR 97330, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16486
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera cultivar Pinot Noir"
FT                   /isolate="OR2"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Oregon"
FT                   /note="causes systemic infection in grapevines"
FT                   /db_xref="taxon:64003"
FT   gene            106. .8916
FT                   /gene="ORF1a"
FT   CDS             106. .8916
FT                   /codon_start=1
FT                   /gene="ORF1a"
FT                   /product="ORF1a"
FT                   /note="contains 2 papain-like proteases, methyltransferase,
FT                   and helicase"
FT                   /protein_id="AFG26690.1"
FT                   /translation="MSSLAISALPCSVAQLSVGQPVATVARSFLMTSLPSLQTYPSSSE
FT                   LTSFLFCFGAFQKIKMFLSFLRSVHVFAPFSEISTIGSCYEFIRLGGGAYPLFFCSFQC
FT                   GPLSVSLGFVNGVFAVLNMSFPFLSNASLLTGVGKNVVQEKIKISKFEKKQKKRVFSIA
FT                   RATARHVPSRRNPKEKRVVHVQHLPSGSLRFSQNKNKTELLILKEEVGIVARVKCSASV
FT                   VRRRVCGGVVKCKPLIAVSPSGVKFRCFAPSCSTSACLKLKIMRRVAVGDCRGEKIIAA
FT                   RRAALQKQAFNSRTPKKVRENPISVSGVNLGRSATAQVIYFGSFTQPFALYPRQESAIV
FT                   KTQPPPVSVVKVECVAAEVAPNRGVVDKKPTSVGVPPQRGVLSFPTVVRNRGDVIIAGV
FT                   VHEALKKIKDGLLRFRVGGDMRFSRFFSSNYGCRFVASVRTNTTVWLNCTKASGEKFSL
FT                   AAACTADYVAMLRYVCGGKFPLVLMSRVIYPEGRCYLAHMRYLCAFYCRPFRESDYALG
FT                   MWPTVARLRACVEKNFGVEACGIALRGYYTSRNVYHCDYDSAYVKYFRNLSGRIGGGSF
FT                   DPTSLTSVITVKISGLPGGLPKNIAFGAFLCDIRYVEPVDSGGIQSSVKTKREDAHRTV
FT                   EERAAGGSVEQPRQKRIDEKGCGRVPSGGFPHLLVGSLNEVRRKVAAGLLRFRVGGDMD
FT                   FHRSFSTQAGHRLLVWRRSSRSVCLELYSPSKNFLRCDVLPCSGDYAAMFSFAAGGRFP
FT                   LVLMTRIRYPNGFCYLAHCRYACAFLLRGFDPKRFDIGAFPTAAKLRNRMVSELGERSL
FT                   GLNLYGAYTSRGVFHCDYDAKFIKDLRLMSAVIAGKDGVEEVVPSDITPAMKQKTIEAV
FT                   YDRLYGGTDSLLKLSIEKDLIDFKNDVQSLKKDRPIVKVPFYMSEATQNSLTRFYPQFE
FT                   LKFSHSSHSDHPAAAASRLLENETLVRLCGNSVSDIGGCPLFHLHSKTQRRVHVCRPVL
FT                   DGKDAQRRVVRDLQYSNVRLGDDDKILEGPRNIDICHYPLGACDHESSAMMMVQVYDAS
FT                   LYEICGAMIKKKSRITYLTMVTPGEFLDGRECVYMESLDCEIEVDVHADVVMYKFGSSC
FT                   YSHKLSIIKDIMTTPYLTLGGFLFSVEMYEVRMGVNYFKITKSEVSPSISCTKLLRYRR
FT                   ANSDVVKVKLPRFDKKRRMCLPGYDTIYLDSKFVSRVFDYVVCNCSAVNSKTFEWVWSF
FT                   IKSSKSRVIISGKIIHKDVNLDLKYVESFAAVMLASGVRSRLASEYLAKNLSHFSGDCS
FT                   FIEATSFVLREKIRNMTLNFNERLLQLVKRVAFATLDVSFLDLDSTLESITDFAECKVA
FT                   IELDELGCLRAEAENEKIRNLAGDSIAAKLASEIVVDIDSKPSPKQVGNSSSENADKRE
FT                   VQRPGLRGGSRNGVVGEFLHFVVDSALRLFRYATDQQRIKSYVRFLDSAVSFLDYNYDN
FT                   LSFILRVLSEGYSCMFAFLANRGDLSSRVRSAVRAVKEVATSCANASVSKAKVMITFAA
FT                   AVCAMMFNSCGFSGDGREYKSYIHRYTQVLFDTIFFEDSSYLPIEVLSSAICGAIVTLF
FT                   SSGSSISLNAFLLQITKGFSLEVVVRNVVRVTHGLSTTATDGVIRGVFSQIVSHLLVGN
FT                   TGNVAYQSAFIAGVVPLLVKKCVSLIFILREDTYSGFIKHGISEFSFLSSILKFLKGKL
FT                   VDELKSIIQGVFDSNKHVFKEATQEAIRTTVMQVPVAVVDALKSAAGKIYNNFTSRRTF
FT                   GKDEGSSSDGACEEYFSCDEGEGPGLKGGSSYGFSILAFFSRIMWGARRLIVKVKHECF
FT                   GKLFEFLSLKLHEFRTRVFGKNGTDVGVYDFLPTDIVETLSSIEECDQIEELLGDDLKG
FT                   DKDASLTDMNYFEFSEDFLASVEEPPFAGLRGGSKNVAILAILEYVHNLFRIVASKCSK
FT                   RPLFLAFAELSSALIEKFKEVFPRKSQLVAIVREYTQRFLRSRMRALGLNNEFVVKSFA
FT                   DLLPALMKRKVSGSFLASVYRPLRGFSYMCVSAERREKFFALVCLIGLSLPFFVRIVGA
FT                   KACEELVSSARRLYERIKIFLRQKYVSLSNFFCHLFSSDVDDSSASAGLKGGASRMTLF
FT                   HLLVRLASALLSLGWEGLKLLLSHHNLLFLCFALVDDVNVLIKVLGGLSFFVQPIFSLF
FT                   AAMLLQPDRFVGYSEKLVTAFEFFLKCSPRAPALLKGFFECVANSTVSKTVRRLLRYFV
FT                   RMLKLRKGRGLRADGRGLHRQKAVPVIPSNRVVTDGVERLSVKMQGVEALRTELRILED
FT                   LDSAVIEKLNRRRNRDTNDDEFTRPAHEQMQEVTTFCSKANSAGLALERAVLVEDAIKS
FT                   EKLSKTVNEMVRKGSTTSEEVAVALSDDEAVEEISVADERDDSPKTVRISEYLNRLNSS
FT                   FEFPKPIVVDDNKDTGGLTNAVREFYYMQELALFEIHSKLCAYYDQLRIVNFDRSLAPC
FT                   SEDAQLYVRKNGSTIVQGKEVRLHIKDFHDHDFLFDGKISINKRRRGGNVLYHDNLAFL
FT                   ASNLFLAGYPFSRSFVFTNSSVDILLYEAPPGGGKTTTLIDSFLKVFKKGEVSTMILTA
FT                   NKSSQVEILKKVEKEVSNIECQKRKDKRSPKKSIYTIDAYLMHHRGCDADVLFIDECFM
FT                   VHAGSVLACIEFTRCHKVMIFGDSRQIHYIERNELDKCLYGDLDRFVDLQCRVYGNISY
FT                   RCPWDVCAWLSTVYGNLIATVKGESEGKSSMRINEINSVDDLVPDVGSTFLCMLQSEKL
FT                   EISKHFIRKGLTKFNVLTVHEAQGETYARVNLVRLKFQEDEPFKSIRHITVALSRHTDS
FT                   LTYNVLAARRGDATCDAIQKAAELVNKFRVFPTSFGGSVINLNVKKDVEDNSRCKASSA
FT                   PLSVINDFLNEVNPGTAVIDFGDLSADFSTGPFECGASGIVVRDNISSSNITDHDKQRV
FT                   "
FT   gene            <8915. .10294
FT                   /gene="ORF1b"
FT   CDS             <8915. .10294
FT                   /codon_start=1
FT                   /gene="ORF1b"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="putatively translated through a +1 frameshift
FT                   mechanism"
FT                   /protein_id="AFG26694.1"
FT                   /translation="SVVRSQAIPRRKPSLQENLYSFEARNYNFSTCDRYTSASMFGEAM
FT                   AMNCLRRCFDLDAFSSLRNDVISITRSGIEQWLEKRTPSQIKALMKDVESPLEIDDEIC
FT                   RFKLMVKRDAKVKLDSSCLTKHSPAQNIMFHRKSINAIFSPIFNEVKNRIMCCLKPNIK
FT                   FFTEMTNRDFASVVSNMLGDDDVYHIGEVDFSKYDKSQDAFVKAFEEVMYKELGVDEEL
FT                   LAIWMCGERLSIANTLDGQLSFTIENQRKSGASNTWIGNSLVTLGILSLYYDVRNFEAL
FT                   YISGDDSLIFSRSEISNYADDICTDMGFETKFMSPSVPYFCSKFVVMCGHKTFFVPDPY
FT                   KLFVKLGAVKEDVSMDFLFETFTSFKDLTSDFNDERLIQKLAELVALKYEVQTGNTTLA
FT                   LSVIHCLRSNFLSFSKLYPRVKGWQVFYTSVKKALLKSGCSLFDSFMTPFGQAVMVWDD
FT                   E"
FT   gene            10358. .10528
FT                   /gene="ORF2"
FT   CDS             10358. .10528
FT                   /codon_start=1
FT                   /gene="ORF2"
FT                   /product="ORF2"
FT                   /note="6 kDa small hydrophobic protein"
FT                   /protein_id="AFG26691.1"
FT                   /translation="MNQVLQFECLFLLNLAVFAVTFIFILLVFRVIKSFRQKGHEAPVP
FT                   VVRGGGFSTVV"
FT   gene            10544. .12343
FT                   /gene="ORF3"
FT   CDS             10544. .12343
FT                   /codon_start=1
FT                   /gene="ORF3"
FT                   /product="HSP70h"
FT                   /note="member of the HSP70 family of heat shock proteins"
FT                   /protein_id="AFG26692.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGRVFSFKQNNSAYIPTYLYLFSDSN
FT                   HMTFGYEAESLMSNLKVKGSFYRDLKRWVGCDSSNLDAYLDRLKPHYSVRLVKIGSGLN
FT                   ETVSIGNFGGTVKSEAHLPGLIALFIKAVISCAEGAFACTCTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMINEPSAAALSACNSVGKKSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLTHLFSLTSLEPDLTLDVSNLKESLSKTDAEIVYTLRGV
FT                   DGRKEDVRVNKNILTSVMLPYVNRTLKILESTLKSYAKSMNVSARVKCDLVLIGGSSYL
FT                   PGLADVLTKHQSVDRILRVSDPRAAVAVGCALYSSCLSGSGGLLLIDCAAHTVAIADRS
FT                   CHQIICAPAGAPIPFSGSMPLYLARVNKNSQREVAVFEGEYVKCPKNRKICGANIRFFD
FT                   IGVTGDSYAPVTFYMDFSISSVGAVSFVVRGPEGKQVSLTGTPAYNFSSVALGSRSVRE
FT                   LHISLNNKVFLGLLLHRKADRRILFTKDEAIRYADSIDIADVLKEYKSYAASALPPDED
FT                   VELLLGKSVQKVLRGSRLEEIPL"
FT   gene            12270. .13925
FT                   /gene="ORF4"
FT   CDS             12270. .13925
FT                   /codon_start=1
FT                   /gene="ORF4"
FT                   /product="63 kDa protein"
FT                   /protein_id="AFG26693.1"
FT                   /translation="MSNYSWESLFKKFYGEADWKKYLSRSIAAHSSEIKTLPDIRLYGG
FT                   RVVKKSDFESALPNSFEQELGLFILSEREVGWSKLCGITVEEAAYDLTNPKAYKFTAET
FT                   CSPDVKGEGQKYSMEDVMNFMRLSNLDVNDKMLAEQCWSLSNSCGELINPDDKGRFVAL
FT                   TFKDRDTADDTGAANVECRVGDYLVYAMSLFEQRTQKSQSGNISLYEKYCEYIRTYLGS
FT                   TDLFFTAPDRIPLLTGILYDFCKEYNIFYSSYKRNVDNFRFFLANYMPLISDVFVFQWV
FT                   KPAPDVRLLFELSAAELTLEVPTLSLIDSQVVVGHILRYVESYTSDPAIDALEDKLEAI
FT                   LKSSNPRLSTAQLWVGFFCYYGEFRTAQSRVVQRPGVYKTPDSVGGFEINMKDVEKFFD
FT                   KLQRELPNVSLRRQFNGARAHEAFKIFKNGNISFRPISRLNVPREFWYLNIDYFRHANR
FT                   SGLTEEEILILNNISVDVRKLCAERACNTLPSAKRFSKNHKSNIQSSRQERRIKDPLVV
FT                   LKDTLYEFQHKRAGWGSRSTRDLGSRADHAKGSG"
FT   gene            13837. .14508
FT                   /gene="ORF5"
FT                   /note="CPm"
FT   CDS             13837. .14508
FT                   /codon_start=1
FT                   /gene="ORF5"
FT                   /product="CPm"
FT                   /note="minor capsid protein"
FT                   /protein_id="AFG26695.1"
FT                   /translation="MSSNTSVPVGGLEALETSGVVLTTRKEAVDKFFNELKNENYSSVD
FT                   SSRLSDSEVKEVLEKSKESFKSELASTDEHFVYHIIFFLIRCAKISTSEKVKYVGSHTY
FT                   VVDGKTYTVLDAWVFNMMKSLTKKYKRVNGLRAFCCACEDLYLTVAPIMSERFKTKAVG
FT                   MKGLPVGKEYLGADFLSGTSKLMSDHDRAVSIVAAKNAVDRSAFTGGERKIVSLYDLGR
FT                   Y"
FT   gene            14577. .15173
FT                   /gene="ORF6"
FT                   /note="CP"
FT   CDS             14577. .15173
FT                   /codon_start=1
FT                   /gene="ORF6"
FT                   /product="CP"
FT                   /note="major capsid protein"
FT                   /protein_id="AFG26696.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
FT   gene            15173. .15658
FT                   /gene="ORF7"
FT   CDS             15173. .15658
FT                   /codon_start=1
FT                   /gene="ORF7"
FT                   /product="ORF7"
FT                   /note="19 kDa protein"
FT                   /protein_id="AFG26697.1"
FT                   /translation="MEDYEEKSESLILLRTNLNTMLLVVKSDASVELPKLLICGYLRVS
FT                   GRGEVTCCNREELTRDFEGNHHTVIRSRIIQYDSESAFEEFNNSDCVVKFFLETGSVFW
FT                   FFLRSETKGRAVRHLRTFFEANNFFFGSHCGTMEYCLKQVLTETESIIDSFCEERNR"
FT   gene            15660. .16277
FT                   /gene="ORF8"
FT   CDS             15660. .16277
FT                   /codon_start=1
FT                   /gene="ORF8"
FT                   /product="ORF8"
FT                   /note="24 kDa protein"
FT                   /protein_id="AFG26698.1"
FT                   /translation="MRVIVSPYEAEDILKRSTDMLRNIDSGVLSTKECIKAFSTITRDL
FT                   HCAKASYQWGVDTGLYQRNCAEKRLIDTVESNIRLAQPLVREKVAVHFCKDEPKELVAF
FT                   ITRKYVELTGVGVREAVKREMRSLTKTVLNKMSLEMAFYMSPRAWKNAEWLELKFSPVK
FT                   IFRDLLLDVETLNELCAEDDVHVDKVNENGDENHDLELQDEC"
XX
SQ   Sequence 16486 BP; 4166 A; 3423 C; 4200 G; 4697 T; 0 other;

jq771955 Length: 16486  11-MAY-2012  Type: N  Check: 2748  ..

       1  atattctgtt ggctttcatc tgtgcttgtg cttcggttca atcacactct
      51  gaaagtttca gttccccgga atttcggttt tcttcataag ccttattctt
     101  acaggatgtc tagccttgct atctctgccc ttccctgttc agtcgctcaa
     151  ctgagcgttg gtcagcctgt tgccacggtt gccaggtcat ttttgatgac
     201  ttcccttccg tcccttcaga cttacccatc ttcgtctgag ttgacttcct
     251  ttttattttg ttttggtgct ttccaaaaaa taaaaatgtt tttatctttc
     301  ctacgttcgg tgcacgtctt tgcgcctttt tctgaaattt ccacgattgg
     351  ttcatgctat gaattcattc ggttgggagg tggtgcttac cctctctttt
     401  tctgttcctt ccaatgcgga cctttgtccg tttctttggg ttttgttaac
     451  ggcgtttttg ctgttttaaa catgtcattt cctttcttaa gcaacgcatc
     501  tcttttgacg ggcgtcggaa aaaatgttgt tcaagagaaa ataaaaattt
     551  ccaaatttga gaagaaacag aagaagcgcg ttttttcgat agctcgcgct
     601  accgcgcgtc atgtgccttc ccgtcgcaat cctaaggaga agcgtgttgt
     651  ccatgtacag catctcccta gtggttcttt acgcttttcc caaaacaaaa
     701  acaaaacaga actgctcatc ttaaaagagg aagtcggaat tgtcgcgcgc
     751  gttaagtgtt cggcaagcgt cgtgcgccgt cgcgtttgtg gcggtgtggt
     801  taagtgcaaa cccctaatag ccgtttctcc ctctggcgtg aaattccgtt
     851  gtttcgcgcc gtcttgcagc acgtccgctt gtttaaagct caaaatcatg
     901  cgccgtgttg ccgtcggtga ctgccgaggt gagaagataa tcgcggcacg
     951  acgtgcggcg ctgcagaagc aggctttcaa cagccgcaca ccgaagaaag
    1001  tgcgagagaa ccccattagc gtctccgggg tgaacttggg aaggtctgcc
    1051  accgctcagg ttatttattt cggcagtttc acgcagccct tcgcgttgta
    1101  tccgcgccaa gagagcgcga tcgtaaaaac gcaacctcca ccggtcagtg
    1151  tagtgaaggt ggagtgcgta gctgcggagg tagctcccaa caggggcgtg
    1201  gtcgacaaga aacctacgtc tgttggcgtt cccccgcagc gcggtgtgct
    1251  ttcttttccg acggtggttc ggaaccgcgg cgacgtgata atcgcagggg
    1301  tggtgcatga agccttgaag aaaattaaag acgggctctt acgcttccgc
    1351  gtaggcggtg acatgcgttt ttcgagattt ttctcatcga actacggctg
    1401  cagattcgtc gcgagcgtgc gtacgaacac tacagtttgg ctaaattgca
    1451  cgaaagcgag tggtgagaaa ttctcactcg ccgccgcgtg cacggcggat
    1501  tacgtggcga tgctgcgtta tgtatgtggc gggaaatttc ctctcgtcct
    1551  catgagtaga gttatttacc cggaagggcg ctgttacttg gcccatatga
    1601  ggtatttgtg cgccttttac tgtcgcccgt ttagagagtc ggattatgcc
    1651  ctcggaatgt ggcctacggt ggcgcgtctc agggcatgcg ttgagaagaa
    1701  cttcggtgtc gaagcttgtg gcatagctct tcgtggctat tacacctctc
    1751  gcaatgttta tcactgtgat tatgactctg cttatgtaaa atattttaga
    1801  aacctttccg gccgcattgg cggtggttcg ttcgatccga catctttaac
    1851  ctccgtaata acggtgaaga ttagcggtct tccaggtggt cttcctaaaa
    1901  atatagcgtt tggtgccttc ctgtgcgata tacgttacgt cgaaccggta
    1951  gactcgggcg gcattcaatc gagcgttaag acgaaacgtg aagatgcgca
    2001  ccgaaccgta gaggaacggg cggccggcgg atccgtcgag caaccgcgac
    2051  aaaagaggat agatgagaaa ggttgcggca gagttcctag tggaggtttt
    2101  ccgcatctcc tggtcggcag ccttaacgaa gttaggagga aggtagctgc
    2151  cggacttcta cgctttcgcg ttggcggtga tatggatttt catcgctcgt
    2201  tctccaccca agcgggccac cgcttgctgg tgtggcgccg ctcgagccgg
    2251  agcgtgtgcc ttgaacttta ctcaccatct aaaaactttt tgcgttgcga
    2301  tgtcttgcct tgttctggag actatgcagc gatgttttct ttcgcggcgg
    2351  gcggccgttt ccctttagtt ttgatgacta gaattagata cccgaacggg
    2401  ttttgttact tggctcactg ccggtacgcg tgcgcgtttc tcttaagggg
    2451  ttttgatccg aagcgtttcg acatcggtgc tttccccacc gcggccaagc
    2501  tcagaaaccg tatggtttcg gagcttggtg aaagaagttt aggtttgaac
    2551  ttgtacggcg catatacgtc acgcggcgtc tttcactgcg attatgacgc
    2601  taagtttata aaggatttgc gtcttatgtc agcagttata gctggaaagg
    2651  acggggtgga agaggtggta ccttctgaca taactcctgc catgaagcag
    2701  aaaacgatcg aagccgtgta tgatagatta tatggcggca ctgactcgtt
    2751  gctgaaactg agcatcgaga aagacttaat cgatttcaaa aatgacgtgc
    2801  agagtttgaa gaaagatcgg ccgattgtca aagtgccctt ttacatgtcg
    2851  gaagcaacac agaattcgct gacgcgtttc taccctcagt tcgaacttaa
    2901  gttttcgcac tcctcgcatt cagatcatcc cgccgccgcc gcttctagac
    2951  tgctggaaaa tgaaacgtta gtgcgcttat gtggtaatag cgtttcagat
    3001  attggaggtt gtcctctttt ccatttgcat tccaagacgc aaagacgggt
    3051  tcacgtatgt aggcctgtgt tggatggcaa ggatgcgcag cgtcgcgtgg
    3101  tgcgtgattt gcagtattcc aacgtgcgtt tgggagacga tgataaaatt
    3151  ctggaagggc cacgcaatat cgacatttgc cactatcctc tgggcgcgtg
    3201  tgaccacgaa agtagtgcta tgatgatggt gcaggtgtat gacgcgtccc
    3251  tttatgagat atgtggcgcc atgatcaaga agaaaagccg cataacgtac
    3301  ttaaccatgg tcacgcccgg cgagtttctt gacggacgcg aatgcgtcta
    3351  tatggagtcg ttagactgtg agattgaggt tgatgtgcac gcggacgtcg
    3401  taatgtacaa attcggtagt tcttgctatt cgcacaagct ttcaatcatc
    3451  aaggacatca tgaccactcc gtacttgaca ctaggtggtt ttctattcag
    3501  cgtggagatg tatgaggtgc gtatgggcgt gaattacttc aagattacga
    3551  agtccgaagt atcgcctagc attagctgca ccaagctcct gagatatcga
    3601  agagctaata gcgacgtggt taaagttaaa cttccacgtt tcgataagaa
    3651  acgtcgcatg tgtctgcctg ggtatgacac catataccta gattcgaagt
    3701  ttgtgagtcg cgttttcgat tatgtcgtgt gtaattgctc tgccgtgaac
    3751  tcaaaaactt tcgagtgggt gtggagtttc attaagtcta gcaagtcgag
    3801  ggtgattatt agcggtaaaa taattcacaa ggatgtgaat ttggacctca
    3851  agtacgtcga gagtttcgcc gcggttatgt tggcctctgg cgtgcgcagc
    3901  agactagcgt ccgagtacct tgctaagaac cttagtcatt tttcgggaga
    3951  ttgctccttt attgaagcca cgtctttcgt gttgcgtgag aaaatcagaa
    4001  acatgactct gaattttaac gaaagacttt tacagttagt gaagcgcgtt
    4051  gcctttgcga ccttggacgt gagttttcta gatttagatt caactcttga
    4101  atcaataact gattttgccg agtgtaaggt agcgattgaa ctcgacgagt
    4151  tgggttgctt gagagcggag gccgagaatg aaaaaatcag gaatctagcg
    4201  ggagattcga ttgcggctaa actcgcgagc gagatagtgg tcgatattga
    4251  ctctaagcct tcaccgaagc aggtgggtaa ttcgtcatcc gaaaacgccg
    4301  ataagcggga agttcagagg cccggtttgc gtggtggttc taggaacggg
    4351  gttgttgggg agttccttca cttcgtcgtg gattctgcct tgcgtctttt
    4401  cagatacgcg acggatcaac aacggatcaa gtcttacgtg cgtttcttgg
    4451  actcggcggt ctcattcttg gattacaact acgataatct atcgtttata
    4501  ctgcgagtgc tttcggaagg ttattcgtgt atgttcgcgt ttttggcgaa
    4551  tcgcggcgac ttatctagtc gtgtccgtag cgcggtgcgt gctgtgaaag
    4601  aagttgctac ctcatgcgcg aacgcgagcg tttctaaagc caaggttatg
    4651  attaccttcg cagcggccgt gtgtgctatg atgtttaata gctgcggttt
    4701  ttcaggcgac ggtcgggagt ataaatcgta tatacatcgt tacacgcaag
    4751  tattgttcga cactatcttt tttgaggaca gcagttacct acccatagaa
    4801  gttctgagtt cggcgatatg cggtgctatc gtcacacttt tctcctcggg
    4851  ctcgtccata agtttaaacg ccttcttact tcaaattacc aaaggattct
    4901  ccctagaggt tgtcgtccgg aatgttgtgc gagtcacgca tggtttgagc
    4951  accacagcga ccgacggcgt catacgtggg gttttctccc aaattgtgtc
    5001  tcacttactt gttggaaata ccggtaatgt ggcttaccag tcagctttca
    5051  ttgccggggt ggtgcctctt ttagttaaaa agtgtgtgag cttaatcttc
    5101  atcttgcgtg aagatactta ttccggtttt attaagcacg gaatcagtga
    5151  attctctttc cttagtagta ttctgaagtt cttgaagggt aagcttgtgg
    5201  acgagttgaa atcgattatt caaggggttt ttgattccaa caagcacgtg
    5251  tttaaagaag ctactcagga agcgattcgt acgacggtca tgcaagtgcc
    5301  tgtcgctgta gtggatgccc ttaagagcgc cgcgggaaaa atttataaca
    5351  attttactag tcgacgtacc tttggtaagg atgaaggctc ctctagcgac
    5401  ggcgcatgtg aagagtattt ctcatgcgac gaaggtgaag gtccgggtct
    5451  gaaagggggt tccagctatg gcttctcaat tttagcgttc ttttcacgca
    5501  ttatgtgggg agctcgtcgg cttattgtta aggtgaagca tgagtgtttt
    5551  gggaaacttt ttgaatttct atcgctcaag cttcacgaat tcaggactcg
    5601  cgtttttggg aagaatggaa cggacgtggg agtttacgat tttttgccca
    5651  cggacatcgt ggaaacgctc tcatcgatag aagagtgcga ccaaattgaa
    5701  gaacttctcg gcgacgacct gaaaggtgac aaggatgctt cgttgaccga
    5751  tatgaattac tttgagttct cagaagactt cttagcctct gtcgaggagc
    5801  cgcctttcgc tggattgcga ggaggtagca agaacgtcgc gattttggcg
    5851  attttggaat acgtgcataa tttgtttcgc attgtcgcaa gcaagtgttc
    5901  gaaacgacct ttatttcttg ctttcgccga actctcaagc gcccttattg
    5951  agaaatttaa ggaggttttc cctcgtaaga gccagctcgt cgctatcgtg
    6001  cgcgagtata ctcagagatt cctccgaagt cgcatgcgtg cgttgggttt
    6051  gaataacgag ttcgtggtaa aatctttcgc cgatttgcta cccgcattaa
    6101  tgaagcggaa ggtttcaggt tcgttcttag ctagtgttta tcgcccactt
    6151  agaggtttct catatatgtg tgtttcagcg gagcgacgtg aaaagttttt
    6201  tgctctcgtg tgtttaatcg ggttaagtct ccctttcttc gtgcgcatcg
    6251  taggagcgaa agcgtgcgaa gaactcgtgt cctcagcgcg tcgcctttat
    6301  gagcgtatta aaatttttct aaggcagaag tatgtctctc tttctaattt
    6351  cttttgtcac ttgtttagct ctgacgttga tgacagttcc gcatctgcag
    6401  ggttgaaagg tggtgcgtcg cgaatgacgc tcttccacct tctggttcgc
    6451  cttgctagtg ccctcctatc gttagggtgg gaagggttaa agctactctt
    6501  atcgcaccac aacttgttat ttttgtgttt tgcattggtt gacgatgtga
    6551  acgtccttat caaagttctt gggggtcttt ctttctttgt gcaaccaatc
    6601  ttttccttgt ttgcggcgat gcttttacaa ccggacaggt ttgtggggta
    6651  ttccgagaaa cttgttacag cgtttgaatt tttcttaaaa tgttcgcctc
    6701  gcgcgcctgc actactcaaa gggttttttg agtgcgtggc gaacagcact
    6751  gtgtcaaaaa ccgttcgaag acttcttcgt tatttcgtga ggatgctcaa
    6801  acttcgaaaa gggcgagggt tgcgtgcgga tggtaggggt ctccatcggc
    6851  agaaagccgt acccgtcata ccttctaatc gggtcgtgac cgacggggtt
    6901  gaaagacttt cggtaaagat gcaaggagtt gaagcgttgc gtaccgaatt
    6951  gagaatctta gaagatttag attctgccgt gatcgaaaag ctcaatagac
    7001  gcagaaatcg tgacactaat gacgacgaat ttacgcgccc tgctcatgag
    7051  cagatgcaag aagtcaccac tttctgttcg aaagccaact ctgctggttt
    7101  ggccctggaa agggcagtgc ttgtggaaga cgctataaag tcggagaaac
    7151  tttctaagac ggttaatgag atggtgagga aagggagtac caccagcgaa
    7201  gaagtggccg tcgctttgtc ggacgatgaa gccgtggaag aaatctctgt
    7251  tgctgacgag cgagacgatt cgcctaagac agtcaggata agcgaatacc
    7301  taaataggtt aaactcaagc ttcgaattcc cgaagcctat tgttgtggac
    7351  gacaacaagg ataccggggg tctaacgaac gccgtgaggg agttttatta
    7401  tatgcaagaa cttgctcttt tcgaaatcca cagcaaactg tgcgcctact
    7451  acgatcaact gcgcatagtc aatttcgatc gttccttagc accatgcagc
    7501  gaagatgctc agctgtacgt acggaagaac ggctcaacga tagtgcaggg
    7551  taaagaggta cgtttgcaca ttaaggattt ccacgatcac gatttcctgt
    7601  ttgacggaaa aatttctatt aacaagcggc ggcgaggcgg aaacgtttta
    7651  tatcacgaca acctcgcgtt cttggcgagt aatttgttct tagccggcta
    7701  ccccttttca aggagcttcg tcttcacgaa ttcgtcggtc gatattctcc
    7751  tctacgaagc tccacccgga ggtggtaaga cgacgacgct gattgactcg
    7801  ttcttgaagg tcttcaagaa aggtgaggtt tccaccatga tcttaaccgc
    7851  caacaaaagt tcgcaggttg agatcctaaa gaaagtggag aaggaagtgt
    7901  ctaacattga atgccagaaa cgtaaagaca agagatctcc gaaaaagagc
    7951  atttacacca tcgacgctta tttaatgcat caccgtggtt gtgatgcaga
    8001  cgttcttttc atcgatgagt gtttcatggt tcatgcgggt agcgtactag
    8051  cttgcattga gttcacgagg tgtcataaag taatgatctt cggggatagc
    8101  cggcagatcc actacattga aaggaacgaa ttggacaagt gtttgtatgg
    8151  ggatctcgac aggttcgtgg acctgcagtg tcgggtttat ggtaatattt
    8201  cgtaccgttg tccatgggat gtgtgcgctt ggttaagcac agtgtatggc
    8251  aacctaatcg ccaccgtgaa gggtgaaagc gaaggtaaga gcagcatgcg
    8301  cattaacgaa attaattcag tcgacgattt agtccccgac gtgggttcca
    8351  cgtttctgtg tatgcttcag tcggagaagt tggaaatcag caagcacttt
    8401  attcgcaagg gtttgactaa atttaacgtt ctaacggtgc atgaggcgca
    8451  aggtgagacg tatgcgcgtg tgaaccttgt gcgacttaag tttcaggagg
    8501  atgaaccctt taaatctatc aggcacataa ccgtcgctct ttctcgtcac
    8551  accgacagct taacttataa cgtcttagct gctcgtcgag gtgacgccac
    8601  ttgcgatgcc atccagaagg ctgcggaatt ggtgaacaag tttcgcgttt
    8651  ttcctacatc ttttggtggt agtgttatca atctcaacgt gaagaaggac
    8701  gtggaagata acagtaggtg caaggcttcg tcggcaccat tgagcgtaat
    8751  caacgacttt ttgaacgaag ttaatcccgg tactgcggtg attgattttg
    8801  gtgatttgtc cgcggacttc agtactgggc cttttgagtg cggtgccagc
    8851  ggtattgtgg tgcgggacaa catctcctcc agcaacatca ctgatcacga
    8901  taagcagcgt gtttagcgta gttcggtcgc aagcgattcc gcgtagaaaa
    8951  ccttctctac aagaaaattt gtattcgttt gaagcgcgga attataactt
    9001  ctcgacttgc gaccgttaca catctgcttc aatgttcgga gaggctatgg
    9051  cgatgaactg tcttcgtcgt tgcttcgacc tagatgcctt ttcgtccctg
    9101  cgtaatgatg tgattagtat cacacgttca ggcatcgaac aatggctgga
    9151  gaaacgtact cctagtcaga ttaaagcatt aatgaaggat gttgaatcgc
    9201  ctttggaaat tgacgatgaa atttgtcgtt ttaagttgat ggtgaagcgt
    9251  gacgctaagg tgaagttaga ctcttcttgt ttaactaaac acagccccgc
    9301  tcaaaatatc atgtttcatc gcaagagcat taatgctatc ttctctccta
    9351  tctttaatga ggtgaaaaac cgaataatgt gctgtcttaa gcctaacata
    9401  aagtttttta cggagatgac taacagggat tttgcttctg ttgtcagcaa
    9451  catgcttggt gacgacgatg tgtaccatat aggtgaagtt gatttctcaa
    9501  agtacgacaa gtctcaagat gctttcgtga aggcttttga agaagtgatg
    9551  tataaggaac tcggtgttga tgaagagttg ctggctatct ggatgtgcgg
    9601  cgagcggtta tcgatagcta acactctcga tggtcagttg tccttcacga
    9651  tcgagaatca aaggaagtcg ggagcttcga acacttggat tggtaactct
    9701  ctcgtcactt tgggtatttt aagtctttac tacgacgtta gaaatttcga
    9751  ggcgttgtac atctcgggcg atgattcttt aattttttct cgcagcgaga
    9801  tttcgaatta tgccgacgac atatgcactg acatgggttt tgagacaaaa
    9851  tttatgtccc caagtgtccc gtacttttgt tctaaatttg ttgttatgtg
    9901  tggtcataag acgttttttg ttcccgaccc gtacaagctt ttcgtcaagt
    9951  tgggagcagt caaagaggat gtttcaatgg atttcctttt cgagactttt
   10001  acctccttta aagacttaac ctccgatttt aacgacgagc gcttaattca
   10051  aaagctcgct gaacttgtgg ctttaaaata tgaggttcaa accggcaata
   10101  ccaccttggc gttaagtgtg atacattgtt tgcgttcgaa tttcctctcg
   10151  tttagcaagt tgtatcctcg cgtgaaggga tggcaggttt tttacacgtc
   10201  ggttaagaaa gcgcttctca agagtgggtg ttctctcttc gacagtttca
   10251  tgaccccttt tggtcaggct gtcatggttt gggatgatga gtagcgctaa
   10301  cttgtgcgca gtttctttgt tcgtgacata caccttgtgt gtcaccgtgc
   10351  gtttataatg aatcaggttt tgcagtttga atgtttgttt ctgctgaatc
   10401  tcgcggtttt tgctgtgact ttcattttca ttcttctggt cttccgcgtg
   10451  attaagtctt ttcgccagaa gggtcacgaa gcacctgttc ccgttgttcg
   10501  tggcgggggt ttttcaaccg tagtgtagtc aaaagacgcg catatggtag
   10551  ttttcggttt ggactttggc accacattct ctacggtgtg tgtgtacaag
   10601  gatggacgag ttttttcatt caagcagaat aattcggcgt acatccccac
   10651  ttacctctat ctcttctccg attctaacca catgactttt ggttacgagg
   10701  ccgaatcact gatgagtaat ctgaaagtta aaggttcgtt ttatagagat
   10751  ttaaaacgtt gggtgggttg cgattcgagt aacctcgacg cgtaccttga
   10801  ccgtttaaaa cctcattact cggtccgctt ggttaagatc ggctctggct
   10851  tgaacgaaac tgtttcaatt ggaaacttcg ggggcactgt taagtctgag
   10901  gctcatctgc cagggttgat agctctcttt attaaggctg tcattagttg
   10951  cgcggagggc gcgtttgcgt gcacttgcac cggggttatt tgttcagtac
   11001  ctgccaatta tgatagcgtt caaaggaatt tcactgatca gtgtgtttca
   11051  ctcagcggtt atcagtgcgt atatatgatc aatgaacctt cagcggctgc
   11101  gctatctgcg tgtaattcgg ttggaaagaa gtccgcaaat ttggctgttt
   11151  acgatttcgg tggtgggacc ttcgacgtgt ctatcatttc ataccgcaac
   11201  aatacttttg ttgtgcgagc ttctggaggc gatctaaatc tcggtggaag
   11251  ggatgttgat cgtgcgtttc tcacgcacct cttctcttta acatcgctgg
   11301  aacctgacct cactttggat gtctcgaatc tgaaagaatc tttatcaaaa
   11351  acggacgcag agatagttta cactttgaga ggtgtcgatg gaagaaaaga
   11401  agacgttaga gtaaacaaaa acattcttac gtcggtgatg ctcccctacg
   11451  tgaacagaac gcttaagata ttagagtcaa ccttaaaatc gtatgctaag
   11501  agtatgaatg tgagtgcgcg agttaagtgc gatttagtgc tgataggagg
   11551  atcttcatat cttcctggcc tggcagacgt actaacgaag catcagagcg
   11601  ttgatcgtat cttaagagtt tcggatcctc gggctgccgt ggccgtcggt
   11651  tgcgcattat attcttcatg cctctcagga tctggggggt tgctactgat
   11701  cgactgtgca gctcacactg tcgctatagc ggacagaagt tgtcatcaaa
   11751  tcatttgcgc tccagcgggg gcaccgatcc ccttttcagg aagcatgcct
   11801  ttgtacttag ccagggtcaa caagaactcg cagcgtgaag tcgccgtgtt
   11851  tgaaggggag tacgttaaat gccctaagaa cagaaagatc tgtggagcaa
   11901  atataagatt ttttgatata ggagtgacgg gtgattcgta cgcacccgtt
   11951  accttctata tggatttctc catttcaagc gtaggagccg tttcattcgt
   12001  ggtgagaggt cctgagggta agcaagtgtc actcactgga actccagcgt
   12051  ataacttttc gtctgtggct ctcggatcac gcagtgtccg agaattgcat
   12101  attagtttaa ataataaagt ttttctcggt ttgcttctac atagaaaggc
   12151  ggatcgacga atacttttca ctaaggatga agcgattcga tacgccgatt
   12201  caattgatat cgcggatgtg ctaaaggaat ataaaagtta cgcggccagt
   12251  gccttaccac cagacgagga tgtcgaatta ctcctgggaa agtctgttca
   12301  aaaagtttta cggggaagca gactggaaga aatacctctc taggagcata
   12351  gcagcacact caagtgaaat taaaactcta ccagacattc gattgtacgg
   12401  cggtagggtt gtaaagaagt ccgatttcga atcagcactt cctaattctt
   12451  ttgaacagga attaggactg ttcatactga gcgaacggga agtgggatgg
   12501  agcaaattat gcggaataac ggtggaagaa gcagcatacg atcttacgaa
   12551  tcccaaggct tataaattca ctgccgagac atgtagcccg gatgtaaaag
   12601  gtgaaggaca aaaatactct atggaagacg tgatgaattt catgcgttta
   12651  tcaaatctgg atgttaacga caagatgctg gcggaacagt gttggtcgct
   12701  gtccaattca tgcggtgaat tgatcaaccc agacgacaaa gggcgattcg
   12751  tggctctcac ctttaaggac agagacacag ctgatgacac gggtgccgcc
   12801  aacgtggaat gtcgcgtggg cgactatcta gtttacgcta tgtccctgtt
   12851  tgagcagagg acccaaaaat cgcagtctgg caacatctct ctgtacgaaa
   12901  agtactgcga atatatcagg acctacttag ggagtacgga cctgtttttc
   12951  acagcgccgg acaggattcc gttacttacg ggcatcctgt acgatttttg
   13001  taaggaatac aacattttct actcgtcata taagagaaac gtcgataatt
   13051  tcagattctt cttggcaaat tatatgcctt tgatatctga cgtctttgtc
   13101  ttccagtggg taaaacccgc gccggatgtt cggctgcttt ttgagttaag
   13151  tgcagcggaa ctaacgctgg aggttcccac actgagtttg atagattctc
   13201  aagttgtggt aggccatatc ttaagatacg tagaatccta cacatcagat
   13251  ccagccatcg acgcgttaga agacaaactg gaagcgatac tgaaaagtag
   13301  caatccccgt ctatcgacag cgcaactatg ggttggtttc ttttgttact
   13351  atggtgagtt tcgtacggct caaagtagag tagtgcaaag accaggcgta
   13401  tacaaaacac ctgactcagt gggtggattt gaaataaaca tgaaagatgt
   13451  tgagaaattc ttcgataaac ttcagagaga attgcctaat gtatctttgc
   13501  ggcgtcagtt taacggagct agagcgcatg aggctttcaa aatatttaaa
   13551  aacggaaata taagtttcag acctatatcg cgtttaaacg tgcccagaga
   13601  gttctggtat ctgaacatag actacttcag gcacgcgaat aggtccgggt
   13651  taaccgaaga agaaatactc atcctaaaca acataagcgt tgatgttagg
   13701  aagttatgcg ctgagagagc gtgcaatacc ctacctagcg cgaagcgctt
   13751  tagtaaaaat cataagagta atatacaatc atcacgccaa gagcggagga
   13801  ttaaagaccc attggtagtc ctgaaagaca ctttatatga gttccaacac
   13851  aagcgtgccg gttgggggtc tcgaagcact cgagacctcg ggagtcgtgc
   13901  tgaccacgcg aaaggaagcg gttgataagt ttttcaatga actaaaaaac
   13951  gaaaattact catcagttga cagcagccga ttaagcgatt cggaagtaaa
   14001  agaagtgtta gagaaaagta aagaaagttt caaaagcgaa ctggcctcca
   14051  ctgacgagca cttcgtctac cacattatat ttttcttaat ccgatgtgct
   14101  aagatatcga cgagtgaaaa ggtgaagtac gttggtagtc atacgtacgt
   14151  ggtcgacgga aaaacgtaca ccgttcttga cgcttgggta ttcaacatga
   14201  tgaaaagtct cacgaagaag tacaaacgag tgaatggtct gcgtgcgttc
   14251  tgttgcgcgt gcgaagatct atatctaacc gtcgcaccaa taatgtcaga
   14301  acgctttaag actaaagccg tagggatgaa aggtttgcct gttggaaagg
   14351  aatacttagg cgccgacttt ctttcgggaa ctagcaaact gatgagcgat
   14401  cacgacaggg cggtctccat cgttgcagcg aaaaacgctg tcgatcgtag
   14451  cgctttcacg ggtggggaga gaaagatagt tagtttgtat gatctaggga
   14501  ggtactaagc acggtgtgct atagtgcgtg ctataataat aaacactagt
   14551  gcttaagtcg cgcagaagaa aacgctatgg agttgatgtc cgacagcaac
   14601  cttagcaacc tggtgataac cgacgcctct agtctaaatg gtgtcgacaa
   14651  gaagctttta tctgctgaag ttgtaaaaat gttggtgcag aaaggggctc
   14701  ctaacgaggg tatagaagtg gtgttcggtc tactccttta cgcactcgcg
   14751  gcaagaacca cgtctcctaa ggttcagcgc gcagattcag acgttatatt
   14801  ttcaaatagt ttcggagaga ggaatgtggt agtaacagag ggtgacctta
   14851  agaaggtact cgacgggtgt gcgcctctca ctaggttcac taataaactt
   14901  agaacgttcg gtcgtacttt cactgaggct tacgttgact tttgtatcgc
   14951  gtataagcac aaattacccc aactcaacgc tgcggcggaa ttggggattc
   15001  cagctgaaga ttcgtactta gctgcagatt ttctgggtac ttgcccgaag
   15051  ctctctgaat tacagcaaag taggaagatg ttcgcgagta tgtacgctct
   15101  taaaactgaa ggtggagtgg taaatacgcc agtgagcaat ctgcgtcagc
   15151  taggtagaag ggaagttatg taatggaaga ttacgaagaa aaatccgaat
   15201  cgctcatact gctacgcacg aatctgaaca ctatgctttt agtggtcaag
   15251  tccgatgcta gtgtagagct gcctaaacta ctaatttgcg gttacttacg
   15301  agtgtcagga cgtggggagg tgacgtgttg caaccgtgag gaattaacaa
   15351  gagattttga gggcaatcat catacggtga tccgttctag aatcatacaa
   15401  tatgacagcg agtctgcttt tgaggaattc aacaactctg attgcgtagt
   15451  gaagtttttc ctagagactg gtagtgtctt ttggtttttc cttcgaagtg
   15501  aaaccaaagg tagagcggtg cgacatttgc gcaccttctt cgaagctaac
   15551  aatttcttct ttggatcgca ttgcggtacc atggagtatt gtttgaagca
   15601  ggtactaact gaaactgaat ctataatcga ttctttttgc gaagaaagaa
   15651  atcgttaaga tgagggttat agtgtctcct tatgaagctg aagacattct
   15701  gaaaagatcg actgacatgt tacgaaacat agacagtggg gtcttgagca
   15751  ctaaagaatg tatcaaggca ttctcgacga taacgcgaga cctacattgt
   15801  gcgaaggctt cctaccagtg gggtgttgac actgggttat atcagcgtaa
   15851  ttgcgctgaa aaacgtttaa ttgacacggt ggagtcaaac atacggttgg
   15901  ctcaacctct cgtgcgtgaa aaagtggcgg ttcatttttg taaggatgaa
   15951  ccaaaagagc tagtagcatt catcacgcga aagtacgtgg aactcacggg
   16001  cgtgggagtg agagaagcgg tgaagaggga aatgcgctct cttaccaaaa
   16051  cagttttaaa taaaatgtct ttggaaatgg cgttttacat gtcaccacga
   16101  gcgtggaaaa acgctgaatg gttagaacta aaattttcac ctgtgaaaat
   16151  ctttagagat ctgctattag acgtggaaac gctcaacgaa ttgtgcgccg
   16201  aagatgatgt tcacgtcgac aaagtaaatg agaatgggga cgaaaatcac
   16251  gacctcgaac tccaagacga atgttaaaca ttggttaagt ttaacgaaaa
   16301  tgattagtaa ataataaatc gaacgtgggt gtatctacct gacgtatcaa
   16351  cttaagctgt tactgagtaa ttaaaccaac aagtgttggt gtaatgtgta
   16401  tgttgatgta gagaaaaatc cgtttgtaga acggtgtttt tctcttcttt
   16451  atttttaaaa aaaaataaaa aaaaaaaaaa agaagc