Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate A18, complete genome.

ACC No: JQ798289

Dated: 2012-06-11 | Length: 19302 | CRC: 835947951

                
ID   JQ798289; SV 1; linear; genomic RNA; STD; VRL; 19302 BP.
XX
AC   JQ798289;
XX
DT   11-JUN-2012 (Rel. 113, Created)
DT   11-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate A18, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19302
RA   Sindhvajiva K., Paradornuwat A., Chowpongpang S., Vichukit V.;
RT   "Genome of Citrus Tristeza Virus Isolate A18 from Mandarin Citrus in
RT   Thailand";
RL   Unpublished.
XX
RN   [2]
RP   1-19302
RA   Sindhvajiva K., Paradornuwat A., Chowpongpang S., Vichukit V.;
RT   ;
RL   Submitted (19-MAR-2012) to the INSDC.
RL   Department of Plant Pathology, Faculty of Agriculture, Kasetsart
RL   University, 50 Ngam Wong Wan Rd., Ladyaow, Chatuchak, Bangkok 10900,
RL   Thailand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19302
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata (mandarin)"
FT                   /isolate="A18"
FT                   /mol_type="genomic RNA"
FT                   /country="Thailand:Chiang Mai"
FT                   /isolation_source="host with severe stem pitting"
FT                   /collected_by="Ampaiwan Paradornuwat"
FT                   /collection_date="May-2010"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .106
FT   CDS             107. .9505
FT                   /codon_start=1
FT                   /product="polyprotein"
FT                   /note="ORF1a_p349; contains papain-like leader protease I
FT                   and II, methyltransferase, inter domain region and
FT                   helicase-like domains"
FT                   /protein_id="AFL55384.1"
FT                   /translation="MSKLGARFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTKV
FT                   VKEFSAPMPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLSAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMK
FT                   RVDPTMHESPQDEIKCKGRRHGKTSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIC
FT                   FGTVPTTAWCSQADAAVLRCRLDYHAAETSFRNEGKHVKYVYNDVSSAAVRPRTVSSRK
FT                   GGSVFPRKSKRGVEAPSGRDHHTAFGKSSRASAFFSEAVPRVRLFPPARNIFFTSVVSE
FT                   RRVCYYKPGPGGRGSVLRSDGVNTARLDVVAPAYYAYAKSLGAKGRFLGESSNLDNAKV
FT                   RDGQCYVRHVFNGPLYFGKRANLSGRKARGMSPTGGALKVYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGASAHVLIGQIRVGVPGGVSKPSRSAVRRRNR
FT                   RMREDGFLGSSGSSSSGGSRYCSDCSTPRSLPSPSVFGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKPFYTRFENGEDFAVMRRASVG
FT                   GLLPYFVKRGVVLRLVSLCRASRYEHHYDASIEKPGLSWVQKTSFRMVEVNTSVGRSRT
FT                   SRFLPLAFRTEFTGLTLTNPSGVLFKLLPVLNESSSTRLRGASSPRTLISWLKGSGLGV
FT                   KGGSPSRLLEYAARGQRSTWNVGKIWGISVFPRGTVYNARVDERCLNKRVLKLRDTSAS
FT                   SFLRIVLLARLSSYRPSLSDGEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPF
FT                   GVYLYTRHAFDIYSGKLLELDSYGFSEDLRDGYCYIRHIAEVCLSMGKIFFRRDVNLGA
FT                   FPYVFEVQHRLERLYGKLAVEYGVRGYFSAPRLYHCCYTDSPRPLRSLNKYHRMGGEDG
FT                   PLLITDTDRLRAVGSAYEKVKGRLPDSLLVRSVEKDLIEFNQTLVDAQRARPGVVVPFQ
FT                   MSESQQVMLTRAYPEFNINFTHSVHSDHPVAAGSRALENHLVRKYAGSDYSDVGGCPLF
FT                   HLRAGHSGVHVCRPVYDIKDAHRRVVRHHQLGRVALDHTDGSKQVGAVNTNSVCGNVLG
FT                   ECFHASDAIVMVQVYDVPLRELCRAMINKKASVCYMTVVTPGELLDARESFFIKELDCS
FT                   VELDAVADRVVYCFNNSAYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCIT
FT                   KSRVCPRISEIKRLRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYV
FT                   VNNCVVVNAKTFEWTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGR
FT                   QNAEAFSRRLAAFSGDTSLFELVRFAISEKCRDLFVGIQEAVERCVKSYLRNSFNMSFV
FT                   DLSDPLLTISEYSELDVPIDLPGFGCIAEEDEAKLIEDGVKSALLRKAVRDEAQLILER
FT                   GGTSEIVPCGDEDTSSGDDSTCFLDSDGVSPSGGSSGGLRAGAAPSLFRCLLKNLGGGF
FT                   CMAKRLLELLCKRVVDSFSRLKLGTTRLTSFANLLLVSVSRNFFDDTVFAAVWEIAINL
FT                   TRIVDGVSKTKLECFRNLFRLIPKLYAGCKDVVKDVSNAYRSVVLFSAEFFGKSYSKLC
FT                   QFCLEIFDIGLIEISARNLGLETCVSMAPAIFDVLITFPLGSVSFPVVCARVFGALAME
FT                   VGSNFCFKKVFGKPETLGEDAFRRTCKYGFEAKAFDKLSVDAKGLVRCSGVIPGVLRII
FT                   LSSLFSEADAWVGYSKHEVSSLPIVTFCVKKLSFLLERCKEACIAFIVDSAKKILKSLT
FT                   SEIHESFQNSELTSGAKSLYGHVSSILSASNGLVNKAGNAVAAVKAAGSGLSKRMRRIR
FT                   PSFRLARCVNEQTSEYYSASDESELDESLLSDTPGLRGNGKCSDLFRVVSGRVSVCCRH
FT                   AVEALRRLALHVGDYLYSCIMDSFVRLFVRANTAVGKCESFAVDCATKISDLVVGYIAW
FT                   RNLHSGAYSTTPGLSGGSRNSLSRFLDGGLMVCNSKFWYRVADRFSMRLLSSLAHRMRT
FT                   ASINVLLEFLKNLPVCLVSIYTFIECRSRIFPLKEFLWGFCVFVWNIVKDLSICIYGSL
FT                   PVCVTRLCNRAFRRSSNEGDVGTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSP
FT                   DSPSFPPTYGEIEELGNDSSDSARLIGVDNGSDSVSTEGETELDSDGDSDDSIPLDRDF
FT                   EQIGGLGGSGNIDVFRLGLRFVWRVLRNLFNLRAVKFSYGLALQCIFNGGSNGQFTSRL
FT                   LFSFRQTAYPFEFFRHVCSVRWLSKSLALRVRNRLICDEEMVERFFSFSRFLYDSRYLS
FT                   DVFSVLERVDFYLSYLFSLPKRCLTRNRSVRVCARAPVPVIRTEGLVEDGKKSLTEVLN
FT                   SLDSLKVSDRKGKSALIESDNSDSESGHSFGSRSFGSVKEEVLNAVNGDGVCEKAPLMK
FT                   HATALSKLEPDPSGRKDIPVSKKTFTRGECSGVKSKVSMCDYLVTLNSSFGTVPDMYPV
FT                   ARDITYKKLTNAMREFYYSQKVTLYELHGKLSSYWDELKAVGFDRKLAKMDLDDDVSVV
FT                   DFNLKVIVGRHGTRPFRNTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFL
FT                   RAVDGKDLTFTNSEHSLIVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEIS
FT                   QRISRELMDRKMLAKHVVKTAGRVFTVDSYLMNHIRLKTDLLFIDECFMVHAGAIGAVV
FT                   EFTSCKAVVFFGDSRQIHYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWL
FT                   SKFYPRHVATAYTGSIGKSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLT
FT                   VGRTKAVPIVNTVHEVQGETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVL
FT                   NSRRYDKTASSIDEAREIFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCIN
FT                   EFLNEVVVASSVVQLGDVSEELSSRPFESGCDNVTVGDTAPPDSGNLHEPARVRRGKVA
FT                   GNSSKKSIAARKPSVVRKS"
FT   CDS             <9429. .10862
FT                   /codon_start=1
FT                   /product="RNA dependent RNA polymerase"
FT                   /note="ORF1b_p54; start codon not determined; ORF1b;
FT                   expressed through +1 ribosomal frameshift from ORF1a"
FT                   /protein_id="AFL55385.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERLVGPSEFGRAM
FT                   AAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIKAVQAELKLPFSVEEQIT
FT                   NFKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPCFDEFKNRVLSSLNDNIV
FT                   FFTEMTNAGLAEIVRRIIGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDTEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQNKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVEAKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSLERLFPFIRGWYVVDALKLRQLRKFANLICERVVYDNRVGYFSYFD
FT                   NPFAKPDASDGQADDIATG"
FT   CDS             10911. .11822
FT                   /codon_start=1
FT                   /product="p33"
FT                   /note="ORF2_p33"
FT                   /protein_id="AFL55386.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDVGYNTADR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKT
FT                   MDKSRFVIRVKAMPASMRGYYSFRAFLSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRMDTAGNVAVTIPNTPLVNAVSPYVAEYNENARSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAVIFI"
FT   CDS             11892. .12047
FT                   /codon_start=1
FT                   /product="p6 small hydrophobic protein"
FT                   /note="ORF3_p6; required for virus movement"
FT                   /protein_id="AFL55387.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHVTV"
FT   CDS             12053. .13837
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /note="ORF4_p65; similar to HSP70h; involved in assembly of
FT                   virion"
FT                   /protein_id="AFL55388.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLVLHAEPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGTKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFVPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LGTVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPARKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13761. .15371
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /note="ORF5_p61; involved in assembly of virion"
FT                   /protein_id="AFL55389.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTMVFT
FT                   KTFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLVPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEHVVESDALDDLSQHVDLRLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAVDREVERPALFRLPQKLLNQDDGESCSLRMSSVEALFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRHMSRD
FT                   VATSGFNLAFHHGRLYDTS"
FT   CDS             15346. .16068
FT                   /codon_start=1
FT                   /product="p27 protein"
FT                   /note="ORF6_p27; minor coat protein; associated with two
FT                   coat proteins; involved in virion assembly"
FT                   /protein_id="AFL55390.1"
FT                   /translation="MAGYTILPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   WMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16160. .16831
FT                   /codon_start=1
FT                   /product="p25 major coat protein"
FT                   /note="ORF7_p25; major coat protein; acts as RNA silencing
FT                   suppressor; involved in virion assembly"
FT                   /protein_id="AFL55391.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16797. .17300
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /note="ORF8_p18"
FT                   /protein_id="AFL55392.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17334. .17693
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /note="ORF9_p13"
FT                   /protein_id="AFL55393.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVVIPLSGGTANESRADRANISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17769. .18317
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /note="ORF10_p20; forms inclusion bodies"
FT                   /protein_id="AFL55394.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSAVD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKVVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18400. .19029
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /note="ORF11_p23; required for asymmetric RNA accumulation;
FT                   RNA-binding protein"
FT                   /protein_id="AFL55395.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTEVKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19030. .19302
XX
SQ   Sequence 19302 BP; 4685 A; 3837 C; 4962 G; 5816 T; 2 other;

jq798289 Length: 19302  11-JUN-2012  Type: N  Check: 8525  ..

       1  aatttcacaa attcaaccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatccggc aaattgcctc actacgccca tacaaacaat
     101  cataacatgt cgaaactcgg agctcgcttc aagtcctcga ctttcgctgt
     151  acgcagcgat tacatcatct cgcgcatctg gcgcgccttt aacaccgttg
     201  gagtcctgca cttcttcggt actgaaacaa ccaccaaggt ggttaaggag
     251  ttttcggctc ctatgccgat agtcccttta cggaaatcct gttttccgtt
     301  ttctgttcgc gctgctgttc gcgcgattaa agctgccgga cgtcctattg
     351  acgctccgcg ctccggatgc ctctgtggcc tccctgttat cgacacatct
     401  ggtgtcgtac gtccccgctc tgtcgcgggc atttggaggt attctctgtg
     451  taaacctccc ctctccgccg ccgccaagaa gtccattcgc aaggcgaaga
     501  aagattctgc tttctttctt agtcgggctt cttctctctt ttcacgggag
     551  gtcccttgcg gcacgcgtca cagacttcgc aggcgcgtta tgaaacgagt
     601  agaccccacc atgcatgaga gtccccaaga cgagatcaaa tgtaaggggc
     651  gccgacatgg caaaacttct gacctcccgt atatggggga agcagcgttg
     701  gatgatatcc ttcgctggat tgagggggta aatcccccgc cgtcgatggt
     751  cgccattccg gtgcccatct gtttcggcac cgtgcccacg acggcatggt
     801  gctcccaagc tgacgcggct gttttgcggt gtcgattgga ctaccatgca
     851  gcggagactt cttttcgtaa cgaagggaag catgtgaagt acgtctacaa
     901  tgacgtgtct tctgctgccg tccgtcctcg tacggtttct tcccgcaaag
     951  gcgggtccgt ttttcccaga aaatctaaac ggggcgttga ggccccctct
    1001  ggaagggacc atcacactgc gttcgggaaa tcttcccgcg ccagcgcttt
    1051  cttctctgag gcggttcccc gcgttcgtct gttcccccca gcgcgaaaca
    1101  tttttttcac ttccgtcgtc agcgaacgac gcgtttgcta ctacaaaccc
    1151  ggcccggggg gtagggggtc tgttttaagg tcggacggtg ttaatacagc
    1201  acgtctcgac gttgttgctc cggcgtacta tgcgtacgct aaatctttgg
    1251  gcgccaaagg gcgttttttg ggggagtcgt ccaatttgga caacgctaaa
    1301  gttcgggacg gccaatgtta tgtccgtcat gtgttcaacg ggcctctcta
    1351  ttttggaaaa cgcgccaacc tttccgggcg aaaagcacgg ggcatgtccc
    1401  ccacaggggg ggcgttaaag gtttatcttg ttcgcgagta cggccgcgat
    1451  tctcttaagg ttcctatgcg ggggacctac acttttggca gcgtgtttca
    1501  ctgcctgtca actaaatctt cagtcgactt gcgatctatt cctaaccatc
    1551  atttagttgg tggggcgtct gctcatgtgt taattgggca gattcgtgtt
    1601  ggtgttcctg gtggagtttc taaaccttca cgttcagctg ttcgcaggcg
    1651  taataggcgc atgcgtgaag acggttttct aggtagttcc ggttcgtctt
    1701  cttcgggagg gtcgagatac tgttcggatt gttcaactcc tcgcagttta
    1751  ccctctccgt cggtttttgg acctactctt ggtcggatac caagtataaa
    1801  ccggaagttc cggtttccag caggcactca gttgagtgtt tctatcccta
    1851  aacgcgacga tgatcgcgtg tacgtgtcgg tcggtcaaga ctttgatgag
    1901  ttgtgccatg ccgtgtgcac gtacgttaag aggtacaact cgagaaaacc
    1951  attttacacg cggtttgaaa acggtgagga ttttgccgtt atgcggcgtg
    2001  cttccgttgg tggtcttcta ccgtatttcg tgaaacgcgg ggtcgtttta
    2051  cggctcgttt ccctgtgtcg ggcatcgagg tatgagcatc attatgatgc
    2101  aagtattgaa aagcccggct tgtcgtgggt gcagaagacc agtttccgaa
    2151  tggttgaagt taatacgtcc gtcggaagga gtcggacgag tcggtttctt
    2201  ccgttagcct tccggaccga atttacaggt ttaactctga ccaatccgtc
    2251  cggagttctg ttcaaactgc ttccggtgtt gaatgaaagt tcttcaaccc
    2301  gtctccgcgg agcgtcttca cctcgaacgc tgatctcttg gttgaagggg
    2351  tccgggcttg gtgtaaaggg tggttctcct agtcggctcc tcgagtatgc
    2401  cgctcgtggg caacgatcca cctggaacgt gggaaagatt tgggggattt
    2451  cagttttccc gagaggcacc gtgtacaacg cacgtgtaga cgagcggtgc
    2501  ttaaacaaac gtgttttgaa gctgcgggac acgtcggcgt cctcctttct
    2551  ccgtatagtt cttttggctc gtttgtcgag ttatcggccc tctttaagtg
    2601  acggggagtt tttcaacaag tgcgttactt ctcggttcgt tgcttgtatt
    2651  gaggcggttg aatcgggtct cgttacagta cactttcgtt ccgacgtgtt
    2701  tcgcgcttct ttcccgtttg gtgtctatct gtacactcgt cacgcttttg
    2751  acatttacag tggtaagctc ctggaattag atagctacgg gttttcggaa
    2801  gacctgaggg acggctactg ttatattcgt cacattgctg aggtctgttt
    2851  gagtatggga aaaattttct ttaggaggga cgttaactta ggggcgtttc
    2901  cttatgtttt cgaggtgcag caccgtcttg agaggttgta tggtaagctg
    2951  gccgttgaat acggcgttag aggttatttt tcagcgccgc gtctctacca
    3001  ttgttgctat accgactcac cgagaccctt gagatcctta aataagtacc
    3051  ataggatggg cggtgaagac ggaccgctgt tgatcacgga tacggacaga
    3101  ctgcgagccg tgggtagcgc ctatgaaaag gtgaaagggc gtttgcccga
    3151  ttcattgctt gttcgatcgg tagaaaagga tttgatagag ttcaaccaaa
    3201  ctctagtcga tgcgcagcga gctagaccgg gcgttgttgt tccttttcaa
    3251  atgagtgaga gccaacaggt gatgctcact agggcttacc ccgagtttaa
    3301  cataaacttt actcattccg tgcactccga tcatccagtg gctgcgggtt
    3351  ctagagcgtt ggaaaaccac ctcgttcgta aatacgccgg cagtgattac
    3401  tcggacgtgg gaggttgccc attatttcac ttgcgtgcgg gtcattctgg
    3451  tgtgcatgtg tgtagaccag tgtacgatat taaggacgct caccgtaggg
    3501  tggttcgcca ccaccaactc ggtagagtcg cgttggacca tactgacggt
    3551  tcgaaacagg ttggcgcggt taacacgaac tccgtatgtg gtaacgtttt
    3601  aggggaatgt tttcatgcgt ctgacgcgat tgtcatggtg caagtttacg
    3651  atgtaccgct acgtgaacta tgcagagcta tgataaacaa gaaagcctcg
    3701  gtatgttaca tgaccgtggt tacacctggt gagttgttgg acgcccgtga
    3751  gtccttcttc atcaaagagt tagactgttc ggtggagttg gacgccgtcg
    3801  ccgatagggt tgtttactgc tttaacaatt cagcgtatac gcatacctat
    3851  tctacgatat gcgagtacat gcgtactcct tgtgtggtgg tggacggttt
    3901  tctgttcact atcgagatgg tttcactcag atgtagcgtt aattattatt
    3951  gtatcaccaa atcgcgggtt tgtccgagaa tcagtgagat taaacggtta
    4001  cgctatcgtc ggtgtgacag tgacttgatt agaattaaga ttcctcggta
    4051  ctctagtaag actcgtagtt gtttaccagg gtgctattac ttgtatttgg
    4101  acgctaagtt tgtgagtcgt gtgtacgaat acgtggttaa taattgtgtt
    4151  gtggtgaacg ctaagacttt tgaatggact tggaactaca tcaagtcctg
    4201  taagtcgaga gtggtcatca gtgggaagat catccatagg gacgttccta
    4251  tcgcgttgga gtacttggat gggttttccg cagttatgct gtccgcgggc
    4301  gtgaaaggta ggcagaacgc agaagcgttt tctaggcgtc tagcggcctt
    4351  ttcaggagac acttctcttt tcgaattggt gaggttcgcc atttcagaga
    4401  agtgtcgcga tttatttgtg ggcattcagg aggctgtgga gagatgcgtg
    4451  aagtcatacc tcagaaactc gtttaatatg agtttcgtgg acttgtctga
    4501  tcctctgctc acaatcagtg agtactcgga gttagatgtt cctatcgatt
    4551  taccgggttt cggctgcata gcggaggagg acgaggctaa actcatagaa
    4601  gatggtgtta agtcggcttt actgcgaaaa gcagttcgtg acgaggcgca
    4651  actcattctt gaaaggggcg gcacgtccga gatcgttccg tgtggggatg
    4701  aagacacttc aagcggcgat gattctacgt gtttcctcga ttcggatggt
    4751  gtttcgcctt caggcggtag ttctggtggt ttgcgagctg gagctgcccc
    4801  ttcactgttt agatgtttgt tgaagaactt gggtgggggt ttttgtatgg
    4851  cgaaaaggtt gttggaactg ttgtgcaagc gggtagttga ctcgttttct
    4901  cgcttgaagc tcggcacaac tcgtttaacc tcattcgcta acctgttact
    4951  tgtgagcgtt tcgcggaatt tcttcgatga cactgttttt gctgctgttt
    5001  gggaaatagc gatcaacctg accaggatcg tcgatggagt gagcaagaca
    5051  aaattggagt gctttcgcaa tttatttcga ttaattccca agttatacgc
    5101  tggttgtaag gacgttgtga aggacgttag taacgcttac aggtcggttg
    5151  ttctgttttc cgctgagttt tttggtaaga gttactctaa actttgtcag
    5201  ttttgcttgg aaatatttga catcgggctt attgagattt cggcccgtaa
    5251  tttgggacta gaaacttgcg tttcaatggc accggctatt tttgatgtgt
    5301  tgattacttt tcctttgggg agcgttagct ttcccgtcgt ttgcgctagg
    5351  gttttcggtg ctctcgctat ggaagtggga tcgaactttt gttttaagaa
    5401  agttttcggt aaacccgaaa ctctaggtga agatgctttc cgtaggacgt
    5451  gtaagtatgg ttttgaggcc aaagcgtttg acaagctttc cgtagatgcg
    5501  aaaggtttag ttaggtgctc tggtgttatt cctggagtgt taaggataat
    5551  actatcttcc ttgttttccg aggcagacgc ttgggtgggt tatagtaaac
    5601  atgaagtttc ttcccttccc atagttacct tttgcgtgaa gaaattgtct
    5651  tttctgttgg agcggtgtaa ggaagcgtgt atcgctttca ttgtcgattc
    5701  tgctaagaag attttgaaat ctttaacttc tgagattcac gagtctttcc
    5751  aaaactcgga attaactagc ggtgctaaat ccttgtatgg acatgtgagt
    5801  tctatactct cagcgtccaa tggtctagtt aacaaggcag ggaacgccgt
    5851  tgcagcggtt aaagcggcgg ggagtggtct tagcaaacgt atgaggcgca
    5901  ttcggccttc ctttcgcctt gctcggtgtg ttaatgaaca gaccagcgaa
    5951  tactactctg ctagtgacga gtctgagttg gatgagtcgt tgcttagtga
    6001  cacacccggt cttcgtggta acgggaagtg tagcgatttg tttcgtgtcg
    6051  tttctggacg tgtctcagta tgttgtaggc acgctgtgga agccttgagg
    6101  cgtttagccc tacacgtcgg tgactacttg tactcgtgca ttatggactc
    6151  ttttgtgagg ttgttcgtaa gagccaacac tgcagtcggg aagtgtgaat
    6201  ccttcgctgt cgattgtgcc actaagattt ctgatttggt agtcggatat
    6251  attgcttggc gcaatcttca ttccggtgcg tattcgacaa ctccaggatt
    6301  atccggcggc agtagaaatt ctctttccag gttcttggac ggcggtctca
    6351  tggtgtgtaa ttcaaaattt tggtaccgcg tggcagaccg gttttcaatg
    6401  agacttttat cgagcttggc tcatcggatg aggactgctt cgataaatgt
    6451  gttgttagag ttcctgaaga acctcccggt ttgtttagtt tcgatataca
    6501  ctttcataga gtgtagatct aggatttttc ctttgaagga gttcctttgg
    6551  ggcttttgcg tttttgtttg gaacattgtt aaggatcttt ccatatgcat
    6601  ctacggaagt ctccccgttt gcgttacgag gttgtgtaat agggcgttcc
    6651  gtcgtagttc caacgaaggt gacgtcggta cgcttcaagt gatcaccgaa
    6701  gccgaaaacc gaatcgagtt tttgcgagaa gttctcgccg aaatggcacg
    6751  gtatcgtgct tctctcgaga tacccgtacc ggggtcgcct gatagtcctt
    6801  cattcccacc tacgtacggt gagattgagg agttaggtaa cgattcctct
    6851  gacagtgccc gattgatagg tgtggacaat ggttcagatt cagtgtccac
    6901  tgaaggcgaa acggaactag attcggatgg tgatagcgat gattcaatac
    6951  ctttagatcg cgactttgag caaatcggag gtcttggcgg gagcggtaac
    7001  attgacgtct ttcgtttagg gctgaggttc gtgtggagag tgttgcgtaa
    7051  tttgtttaac ttaagagccg ttaaattttc ctatgggtta gctcttcagt
    7101  gcatatttaa cggcggttcc aatggccagt ttacgtcgcg actgttattc
    7151  agtttccggc aaactgctta cccgtttgag ttctttagac acgtttgtag
    7201  tgtgaggtgg ctgtcaaaga gcttagcact acgtgttcgt aacaggctaa
    7251  tttgtgacga ggaaatggtt gaacgtttct tcagtttttc gcgatttttg
    7301  tacgattcgc gttacttatc ggacgtgttt tcggtgttgg agagggtcga
    7351  tttttattta agttatctat tctcgttgcc gaagaggtgt cttacgcgta
    7401  accgtagtgt ccgagtttgc gctagagctc cggttcccgt gattaggacc
    7451  gaaggacttg tagaagacgg caagaagtct ttaaccgaag tgttgaactc
    7501  tttggactca ttgaaagtgt ccgaccgtaa agggaagtca gcacttattg
    7551  aaagtgataa ttccgactcc gaaagtggtc attcgttcgg ttcccgctca
    7601  ttcggatccg tcaaggagga agttttaaac gcggtaaacg gtgatggcgt
    7651  ttgcgaaaaa gctccgttga tgaaacacgc taccgcgctt agcaagttgg
    7701  aacccgaccc tagtggtcgt aaagatattc ctgtttccaa gaaaactttt
    7751  acgcgcggtg agtgttcggg cgtgaagtcg aaggtgagca tgtgcgatta
    7801  cttggtgacc ttgaattctt cgtttggtac agtacctgac atgtaccctg
    7851  ttgcgcgtga cataacgtat aagaaactga ctaacgccat gcgcgagttt
    7901  tattactcgc aaaaggtaac gttgtacgaa cttcatggaa agttgagctc
    7951  gtactgggat gagttaaagg cggtaggttt tgataggaag ttggcgaaga
    8001  tggatttgga cgatgacgtt agtgtcgtcg attttaactt gaaggtaata
    8051  gtggggaggc atggtacccg tcctttcaga aatactgtga actctcacga
    8101  gttcatgttt tgtgacgatg gattggtgct ttgcccgggt ccgaaaaaac
    8151  gtgatttcgc tttgatctct agtcaaacgc aatttgttgc tgcgaactca
    8201  ttcctgcgtg ccgtggacgg taaagattta acgttcacta attcggagca
    8251  tagtctcata gtttatgagg ctcctcccgg tggtggaaag acgcattctt
    8301  tggtaacgta tttcgccgac tattgtacca aagtgtcttg cttggtggtg
    8351  accgctaaca aaaattcgca agcggagatt tctcaaagaa tctctagaga
    8401  gttaatggat agaaagatgc ttgctaaaca cgttgttaaa accgctggta
    8451  gagtgtttac tgtggactct tatctgatga accatattcg actcaagacc
    8501  gatttgttgt ttatcgatga gtgttttatg gttcacgctg gagcaatcgg
    8551  agcggttgtt gagttcactt catgtaaggc tgtggttttc ttcggtgata
    8601  gtagacaaat tcattatatt caccggaacg atttcggtgt ttcgttgttg
    8651  catgacatag acgcatttat agaaccgcag caccgcattt acggtgaggt
    8701  gtcctacagg tgtccttggg acatctgtga gtggttgtct aaattttatc
    8751  cgagacatgt agccactgcc tacactggta gtatcgggaa atcgagtgtg
    8801  tctatagaga taattaatgg gtgtgacgac gttccttacg atagtagcgc
    8851  gaagtacatc gtttacacac aagcagaaaa gaacgaactg caaaagcacc
    8901  ttggtcgttt aaccgtaggc cgaactaaag cggtgcctat tgtgaacaca
    8951  gtgcatgaag ttcaaggtga aacctataag aaggttcgtt tggtaaggtg
    9001  caaataccaa gaggacactc ctttctgttc agataatcat gttgttgtgg
    9051  ctttaaccag gcacgtcgat tccttaactt actccgtctt gaatagtagg
    9101  agatacgaca agaccgcttc tagtatagat gaagcaaggg agattttcga
    9151  caagtttcgt tcgacgaacc attctcatgg ttcttcgacg ttggaatggt
    9201  accttgagaa ataccctact gaatataagg gtagtaaggc gtcttcggcg
    9251  ccgttaagtt gtattaacga gtttcttaat gaggtcgtcg ttgcttcttc
    9301  tgtcgtgcag ttgggtgatg tgtctgaaga actgagttca cgtccctttg
    9351  aatcggggtg tgataacgtt accgtaggag acactgcccc tcctgattcc
    9401  ggtaacctac atgaaccggc tcgtgttcgg cgtggtaagg tcgcaggcaa
    9451  ttcctccaag aaaagcatcg ctgcaagaaa accttctgtc gtacgaaagt
    9501  cgtaattaca actttatcaa gacggaacgg cttgtcggac caagcgaatt
    9551  tggtagggcg atggctgctg ctgttatcga acgttgtttc aaaatggaag
    9601  agatggctaa gataaggtgt gatattatat cccttaccga ggctaatatt
    9651  ttgaaatggc tcgacaaacg cactccctgt caaataaagg ccgtgcaggc
    9701  ggagttgaag ctcccctttt cggtggagga gcagattacc aactttaaac
    9751  taatggttaa acgtgatgct aaggtaaaac ttgatgattc gagtctgtct
    9801  aaacatcccg ccgctcagaa tattatgttt cataagaagt ttattaatgc
    9851  tatattttcc ccatgtttcg atgagtttaa aaatagagtg ttatcctcgc
    9901  ttaatgataa tatcgtgttc tttacagaaa tgacgaacgc tgggttagcg
    9951  gaaatcgtca gaagaatcat tggtgacgac gataacttgt tcgtcgggga
   10001  agtggacttc agcaagttcg ataaatctca agatttgttc attaaggagt
   10051  acgaacgtac gttgtattcc gagtttgggt ttgatactga acttctcgat
   10101  gtttggatgg aaggtgaata tcgcgctagg gcaaccacac tggatggtca
   10151  gctgagtttt tcagttgatg gtcagcgtcg ttccggaggt tcaaacactt
   10201  ggatcgggaa ttccttggtt actctaggca ttctttcgtt atattacgac
   10251  gtttcaaagt ttgagttact tctcgtttcc ggtgacgatt ctctgatcta
   10301  ttcaagtgaa aagataagca acttttcttc cgaaatttgt ctagaaacag
   10351  gttttgagac taagtttatg tctcctagtg tgccatactt ttgttcaaag
   10401  tttgtggttc aaactggtaa caaaacatgt tttgtgcctg acccttataa
   10451  attattggta aagttggggg ctccgcaaaa caagttgact gacgatgagt
   10501  tattcgagtt gttcacttct tttaaggaca taactcagga ctttggtgat
   10551  caagtggttt tggagaagct gaagttgcta gtcgaagcta agtacggttt
   10601  cactagtggg accactatgc ccgctctgtg tgctatacat tgtgtacggt
   10651  ctaattattt gtctcttgaa agattgtttc cctttattag aggttggtat
   10701  gttgtcgacg ctttgaagct tagacaactg aggaaattcg ccaatttgat
   10751  ctgtgaacgt gtggtttacg ataatcgcgt gggttatttt tcgtacttcg
   10801  acaatccgtt tgctaaaccc gacgctagcg atggtcaagc ggatgacata
   10851  gcgacaggct gatagtttgt tcagttctcg ctgagagtta acacaggtag
   10901  ttgagtcgag atgtttgcct tcgcgagcga aaaccaagac atattagaag
   10951  aaaagatttt ccgccgtaga acctgccatc gtaagtattt ggatgatgtg
   11001  gttagggatt ttaccattga tgttggttat aatactgccg atcgtgatcc
   11051  tacggtactg gctgattatt tctcgttgta tttctttttg cttaacaatg
   11101  ataacattgg gcctttagca gcttcgatta tagtaagccc acccgtgagt
   11151  gggactcaca aaattcgagc gcacgtcgat aatcaaccga atcgtgaagg
   11201  aaacgtaact tacgttaaga ctatggacaa gagtcggttt gtgattcgcg
   11251  taaaagcgat gccagcttct atgagaggtt actactcttt tcgggcgttt
   11301  cttagtggcg acgtcgctag cgaacgtagt gagttcatat gcagttttgt
   11351  tggtagtagg tttctttgtt gttgtacaca aacgatatcc gaaaatttga
   11401  gtaaagtttg ttcatcttcc ttcttcttta gagctgtttc ggaaaccgct
   11451  actaatgagt tttctgttgt gactgatgat gtagaagacg ttaagtacgt
   11501  aaggaaacga gtcgaggggt tttcacattg cgctgacccg tatcctccta
   11551  ggtgttatcg taacgctaac ttaggcgatt cttcaggggt tcaaagtcgc
   11601  acgattgaag aagaaggtta taggatggat accgcaggta acgtcgcggt
   11651  caccatcccg aacactccac ttgttaacgc cgtctctccg tatgtcgcag
   11701  agtacaacga aaatgcgcgt tcgcgtattt cattaatacg gcgagtttgc
   11751  tgttatgccg tttgcgtttt agtggtgtct cttcttataa tgagcggttt
   11801  gttagccgtt atattcatat gacttggtgt agtaacttat gaggtgtaat
   11851  tagctaaaac tcgccgtttg actctgttta aacggggttc aatggactgt
   11901  gtgattcaag gatttttgac ttttctggtt ggtatagctg tgttttcggc
   11951  ttttgccgga ctgattatca ttgttataac gatttatcgg tgcacgacta
   12001  agcccgttag aaacgcctct ccttacggca ctcacgtcac tgtctaagcg
   12051  gtatggtgct tctgggttta gactttggta ccacgttttc gacggtggct
   12101  atggctacat cttctgagtt agttatactt aaacaatcca attcgtcgta
   12151  catacctacg tgtttggttc tgcatgcgga acctaacagc gtatcttatg
   12201  gttacgatgc ggagtattta gcggcttcag gggaacctgg ctcgttttac
   12251  aaagatttga aacggtgggt cggttgcact gagaagaact accaaagcta
   12301  cttgcacaag ttatcacctt cctataaggt gatagtgaaa gagtttggaa
   12351  ctaagagtat gccggttcca tatttgtcac ctctgaataa cgatcttggg
   12401  ctcagcgtcg ctttgccttc attgatcgct ttatatgcca aatccatttt
   12451  atcggatgcg gaaagagtgt tcaatgtgag ttgcactgga gttatatgtt
   12501  cggtacctgc tggttataac acgttacaac gagcttttac acaacaaagt
   12551  gtgtccttgt cgggttactc ttgcgtgtac attattaatg aaccttctgc
   12601  cgccgcttac tccactttac ctaagttgag ttcggcggat aagtacttgg
   12651  ccgtttacga ctttggtggt gggacctttg atgtttctat agttagtgtt
   12701  aggttgccca cgttcgccgt tagaagttca ggtggtgata tgaacttagg
   12751  cggtagagac atcgatagaa aattatctga taaaatatat gagttggctg
   12801  attttgtacc gcaaaaagaa ctgaacgttt ctagtttaaa ggaagcttta
   12851  tctcttcaaa chgatccagt caagtatact gtaactcatt acggaatgag
   12901  tgaaaccgta tcaattgatc aaacgacgtt gagggagata gcttcggtgt
   12951  ttataactcg aacgatagac atacttacgc aagttaaggc taagtctagt
   13001  atgcccgagt cgcaaagttt gaagctagtg gtagtcggtg gaagctcgta
   13051  cctaccaggg ttgttggaca ctttgggaac cgtacctttt gtgtctggga
   13101  tagtaccagt ggaagacgca agaaccgctg ttgctagggg atgcgcttta
   13151  tatagcgagt gcttggatgg taggtccaag gccttactaa tagattgtat
   13201  tacgcatcat ttgtcggtta cgacttttag tgcagactcg gttgttgttg
   13251  ctgcggccgg aagtccaatt ccttttgaag gagaacgaaa actcacgtta
   13301  cgcaaatgtg ttagtacgtc aaattatcaa gcaagaatgt tcgaaggaga
   13351  ttacgaaaaa gttttccgaa acgaacgtat atacgcagct tcggtatcat
   13401  tgtttacttt aggagttaac tggcgcgtgc ctaacgacgt tgagatgact
   13451  ctcgtgacca aagtggactc gatgggtaaa gtggaattct accttaaagg
   13501  tccatccggt gaattagtta acgtgcaagg tacttcacat tacgattatg
   13551  ttggtatgcc tcatcccgct agaaagttgt tgaggcttag cgattacaat
   13601  gtaaactccg ccgctttagt tttagctttg acgttgactc gcgaaaaacg
   13651  agaaaaattt cttttgcgaa cattgtttga tgctttatta gcagacttgc
   13701  gaaagaccgc gagtttaagc gaatattcta agaaatatcc gattactcga
   13751  aacgacgtcg atgtcgtctc atcacgtatg gggatcgttg tttcgaaagt
   13801  tttacgggga agcgatttgg aaagagtacc tctctgaatc gactcgaaat
   13851  ttcgatgaga gaaacgtatc gttggaccac actttgagtt caggtgtggt
   13901  cgtccgtagg cagagtcttt tgaacgcgcc tcaaggaact ttcgagaacg
   13951  agttagcgct attgtacaat tcggtagtga ttaacgattt tgttgagttg
   14001  actggtatgc cattgaagtc tttgatgaca ggtattgagg accgtaaggt
   14051  acctgacgaa ttaatatccg ttgacccgca tgaagtcgga tgtagattca
   14101  cgttgaatga cgtggaatca tatctaatga gcaggggtga agattccgct
   14151  gatgtaacgg cggtggagca ctcgtggtgt ttgagcaatt cttgtggtag
   14201  attattaagt tcgactgaaa tagatgctta caaaaccatg gtgtttacta
   14251  agacttttga tagtaatgta tctggagtga ccactaaatt agagacgtat
   14301  ctatcgtact gcatatcatt gtacaagaaa cattgtatga aagacgatga
   14351  ttattttaac cttatcttac ctatgtttaa ttgtttgatg aaagtgctgg
   14401  cgtcgcttgg tttgttttac gagaaacata ctgacaatcc gctgctgacc
   14451  ggcatgctca tagagttttg cctagaaaat aaggtgtatt actctacttt
   14501  taaagtaaat ttggacaacg ttaggctgtt taagtctaaa gtgttgcctg
   14551  tggtgttaac ggtttgggat atatctgagc ctgatgaccc agtggatgag
   14601  agggtactag ttcctttcga tcctacggat ttcgtgctgg atttacctaa
   14651  attgaatata cacgacacga tggtggtggt gggtaatcaa atcagacagt
   14701  tagaacacgt agttgagagc gatgctttag acgatttatc tcaacacgtt
   14751  gatttacgtt tagcagcgga caatcccgat ctacgcgttg atctgcgttg
   14801  ggcagggatg tttgtgtatt acggtattta tcggtgtgct gttgatagag
   14851  aggtagaacg accggcgtta tttagattgc cgcagaagtt attgaatcag
   14901  gacgatggtg agtcgtgctc attacgcatg agttccgtcg aagctttatt
   14951  taatctggtg cagaaggtga acaaggacat aaacattagg cgtcagttca
   15001  tgggacgtca tagtaaagtg gctttgcggc tgtatcgcaa cttaggtttg
   15051  aggtttccac cgatctcttc agttaggtta ccggctcatc acggttattt
   15101  atacgtcgat ttttacaaaa gagtacctga tgatgctgtt accgccgacg
   15151  aactcgaaag tttacgtcaa ttacgttcat ccgtggacgt tatgtgtaag
   15201  gacagggtgt caatcacacc tccaccattt aatcgacata gaagaggttc
   15251  ttctagaata cttagaggtc gaggcgcacg cggtgcgagc tcgcgtcata
   15301  tgagcagaga cgtggcaact tccggtttta atttagcctt tcatcatggc
   15351  aggttatacg atacttccta aaactgatga taaagaaatg gatccagtga
   15401  gtgctgctgt gcccggtaaa tacccggacg tcattgaaaa gtttgtgacc
   15451  aataggtcgg tagatgcgtt aatagaaggc gttataagta agttggatac
   15501  caattcaata tacgaagatt ccactgaaaa atttactggt gagcaattga
   15551  agtacgttat ggttactatg gacactttct tattagaaaa ttacaaaacg
   15601  aaaacggaag atctgctggt tcacttggct atgattcaaa agaggttgtg
   15651  cactatatcc acgagtacta aaaccaaatt tcgcgataaa ggttgtatta
   15701  gttacgtgca agggggttta cgatataagt taatggataa agtagttttt
   15751  ccttttatta tatccaagtt taccgacagg gagactccaa acgctctacg
   15801  taagtatgct tgcacttttg aggagttaca cttgtggatg gctaggctga
   15851  gacccgactt atacgaaaac aaaaggacga ccaaagctgg gactccgcat
   15901  ttaaaaggct acctatcagc tgactttctt acgggttcac tcccgggata
   15951  ctccgaacat gaacgaggta tcattcttcg agcgtctgaa tctatgttag
   16001  ctagacgtca aggttacgag gaggcgaccg agcttcttaa cttacgcgat
   16051  ttgggaaagt atttgtagtt agtttgcgga cggtggcatt acgccatccc
   16101  atgagcactg ctttaagggt cgttaattga cgactcttga tatttactaa
   16151  gtttgagtta tggacgacga gacaaagaaa ttgaagaaca aaaacaagga
   16201  aacgaaagaa ggcgacgatg ttgttgcagc cgagtcttct ttcggttccg
   16251  taaacttaca catcgatccg actctgatag cgatgaacga tgtgcgtcag
   16301  ttgggtaccc aacagaacgc cgctttgaac agagatttgt ttcttactct
   16351  gaaagggaag tatcctaact tgtctgacaa ggataaggac ttccacatag
   16401  ctatgatgtt gtatcgttta gcggttaaga gttcatcatt gcaaagtgat
   16451  gacgacacca cgggcataac gtacactcgg gagggtgttg aagtggattt
   16501  gtctgacaaa ctttggactg acgtcgtgtt taactctaag ggtattggta
   16551  accgtactaa cgcccttcga gtctggggta gaactaacga tgccctttat
   16601  ttagcttttt gtagacagaa tcgcaatttg agttatggtg gacgtccgct
   16651  agatgcaggg attccggccg ggtatcatta cctgtgtgca gatttcttga
   16701  ccggagctgg cttgactgat ttagaatgtg ctgtgtacat acaagctaaa
   16751  gaacaattgt tgaagaagcg aggggctgat gaagtcgtag ttactaatgt
   16801  caggcagctt gggaaattta acacacgttg atctattgcg ttctgattcc
   16851  cggtttctat cgggatggtg gagtttcatc gtgaacgtgg gtgatataat
   16901  cgtccggttt gcgttacatg ttcctagtga agatatgctg aatagttttt
   16951  cagctatatc gaattgtacg atcatagcag acggtagtgc tttactaaaa
   17001  gacaacactg tggttgaccg tttagaaggc atgaatcctt tggcttattt
   17051  gttaaaatta gcgaaaacga ctactactat ttgttttact atgtctaata
   17101  aggttctttt tggtactact aaatccgaac cacttagttg tttagctatc
   17151  acgtcggatc gagttttatt caaagttatt atgggtacta acgttgatga
   17201  ttctcgatgc ggctgcagta tttggtttta caacaatggg acgtttcaaa
   17251  acgggttgac ccgttgtaac aatctcgtcg ctttgtttag cgcgacttag
   17301  acacgaagtg achgttcggg tttaattgct gcaatgagta ttcgacgcgt
   17351  gtggttaaag gttatggctg taattactgt attgtggtac ggtaaagagc
   17401  cttcgattag tgaaggttac aatgctctca tgaatgatga ctttaagttt
   17451  atcgatacgc atttttcaaa cgtttcttat gctaagaaat gttacgattt
   17501  ggctaatttc gatttagact ttctacgcat cgttgtcatt cctttgagtg
   17551  gtggtacggc gaatgaatcg cgtgctgatc gcgctaacat ttcagagatt
   17601  gtcgaatcgc atgtaagcga ccgagacaga atgaacatct tgttgcgtaa
   17651  taagcggatc caaattcctt cgctcttacc ttgcgataac tagagtctac
   17701  tcagtagtac gtctactagt ataacgtatt aaacacttta gtaaagggtt
   17751  ttgtttaaac caaacaatat gcgagcttac tttagtgtta acgattacat
   17801  aagccttttg gctaaggtcg gcgcagttgt ggaacgtttg tgcgatccca
   17851  gcgtaactct tacggaagtg atggacgaaa ttaatgactt taactcgttt
   17901  ctcgctttgg tgcactctat gaagtcagac atgaacggag accatcagga
   17951  tggccaccat gagatgggtg aacacaagtc tcgattgtta tgcaatatag
   18001  aggcgaaatt gcgagtactt ctcgacatca taagacgtcg gttcactcgc
   18051  gaaaagctgc tttgtaccag cgcggtagat gtcatgggct ttttcgttat
   18101  gaggtacatg agctccagcc acactagctt cgagtctgta atgagaacgg
   18151  agttgaagtt agtagttaag gtggtactgt cggatctgtc ccgtacgcat
   18201  aagttggatt ttagcgagcg agcttttgct gcttacggta tccttttgca
   18251  aaagggtact gtgtcgaccg tttgcggtca gtttgacatt aatttagtct
   18301  ctccgtcttg cgtgtaggtt aatacatttc tcagaacgcg tggttgtatt
   18351  aactaacttt aattggaaca agtttattgt taaaagtctg cgagttacaa
   18401  tggatagtac tagcggacaa actttcgttt ctgtgaacct ttctgacgaa
   18451  agcaacacag cgagtactga agtcaaaacc gtaagttcag aagcggatcg
   18501  cttggaattt ttacggaaaa tgaatccctt tattatcgac gctttgatac
   18551  ggaaaaatag ttatcagggc gctcgctttc gcgcgagaat aataggagtg
   18601  tgcgtggatt gtggtagaaa acacgataag gggttgaaga ctgaacgtaa
   18651  gtgtaaggtc aacaatacgc agtctcagaa cgaggtggcg catatgttaa
   18701  tgcacgatcc cgttaagtat ttaaataaaa gaaaagctag agccttttct
   18751  aacgcagaga tgtttgcgat cgatttggtt atgtacacca aggaaaggca
   18801  attggcggtt gatttggccg ctgaaaggga gaagacgaga ctggctcgta
   18851  gacacccgat gcgttctccg gaagaaactc cggaacatta taaattcggt
   18901  atgactgcta aagcaatgtt accggacatc aacgctgtag acgttggtga
   18951  taacgaggac acttcgtcgg agtacccagt gagtctgagt gtttctggcg
   19001  gagttctccg tgaacaccac ttcatctgat tgaagtggac ggaataagtt
   19051  cctcgcggaa ctttatgtcg ggttggtaaa aacccttatg atggtgatat
   19101  atcactagac aataaccgga tgggtaaagt ctttaaaatg atcgagggga
   19151  aaattaaccg tatcctctcg ttggtctaag ctcccacaga gtggtagtgg
   19201  tctcaagtga ggcttaacgt atgcgtgaac caaagaagtt ctccttagag
   19251  tgtgtgttgt ttacccaaca cactgtccct atggggggcc aacataggtc
   19301  ca