Sequence of DPV Japanese iris necrotic ring virus

Japanese iris necrotic ring virus isolate Marijiniup10, complete genome.

ACC No: JQ807998

Dated: 2012-06-11 | Length: 4034 | CRC: 1017021523

                
ID   JQ807998; SV 1; linear; genomic RNA; STD; VRL; 4034 BP.
XX
AC   JQ807998;
XX
DT   11-JUN-2012 (Rel. 113, Created)
DT   11-JUN-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Japanese iris necrotic ring virus isolate Marijiniup10, complete genome.
XX
KW   .
XX
OS   Japanese iris necrotic ring virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4034
RA   Wylie S.J., Li H., Jones M.G.K.;
RT   "First report of an isolate of Japanese iris necrotic ring virus from
RT   Australia";
RL   Australas. Plant Dis. Notes 0:0-0(2012).
XX
RN   [2]
RP   1-4034
RA   Wylie S.J., Li H., Jones M.G.K.;
RT   ;
RL   Submitted (22-MAR-2012) to the INSDC.
RL   Plant Virology, WA State Agricultural Biotechnology Centre, Murdoch
RL   University, South Street, Perth, WA 6150, Australia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4034
FT                   /organism="Japanese iris necrotic ring virus"
FT                   /host="Iris ensata"
FT                   /isolate="Marijiniup10"
FT                   /mol_type="genomic RNA"
FT                   /country="Australia"
FT                   /collected_by="Stephen Wylie, Hua Li"
FT                   /collection_date="Aug-2011"
FT                   /db_xref="taxon:77344"
FT   5'UTR           1. .13
FT   CDS             14. .2302
FT                   /codon_start=1
FT                   /transl_except=(pos:746. .748,aa:OTHER)
FT                   /product="P85"
FT                   /note="read-through protein"
FT                   /protein_id="AFL55711.1"
FT                   /translation="MYWFEELALWVLDSRFVPLPIGVIGGAVVICNVATREAAIEAVST
FT                   GITNLIDHVAGALSVGINPLDECKSLLKVVPLHPSMDSLLKNPVLSEDPEECLEVIQAD
FT                   EKSVKKRVNRHSRGTFASHAAIACKMHFGVVPLPTRANLTVATRFVANYCQERHVVPAH
FT                   ARGICDAAIPLIFTPDRGDIGVMAALNHRESQIRRVAVREASNLCTPSMELVQNPFCGS
FT                   AWRRMGRVLVGYEDYTSFQFSKXGGLREMGGVETSVSRGTHPQLTVSREKPASKVRKIY
FT                   QVTGLDSGLNFGVHNNSINNLRRGLIERVFFVESNGILKPPLKPKVHIFMNLRYFRRRL
FT                   CHIVGPYTPIEREEYPLLYQGRRKAIYQNALESLSDRPCTRKDAKLKTFVKAEKINFTF
FT                   KGDPAPRVIQPRDPRYNIEVGKYLKKCEHHIYHAIDTIWGGPTVLKGYTVEQLGNNIAE
FT                   TWNQFQRPCAVGFDAKRFDQHVSVDALRFEHSVYNEIFHSSELARLLSYQLLNCGVAVA
FT                   SDGFAKYKVDGCRMSGDINTALGNCLLSCAITHYLCRGIKCRLINNGDDCVLFFEESDL
FT                   TLVNDRLTKWSDFGFSVKFEEPVYELEKVEFCQMQPVWCNGWVMTRNPYICTSKDTYSI
FT                   TPWHNSASALKWVASVGECGLSLSGGIPVLQSFYSCMMGLSEQRMNIKNDVWFSDSGFA
FT                   RLAASGRRTKTHILEETRVSFWRAFGILPDAQTSIEAVYDEYENNGVFGAGGINSELWT
FT                   SLLKPLHTI"
FT   CDS             14. .748
FT                   /codon_start=1
FT                   /product="P27"
FT                   /note="replication-related protein"
FT                   /protein_id="AFL55710.1"
FT                   /translation="MYWFEELALWVLDSRFVPLPIGVIGGAVVICNVATREAAIEAVST
FT                   GITNLIDHVAGALSVGINPLDECKSLLKVVPLHPSMDSLLKNPVLSEDPEECLEVIQAD
FT                   EKSVKKRVNRHSRGTFASHAAIACKMHFGVVPLPTRANLTVATRFVANYCQERHVVPAH
FT                   ARGICDAAIPLIFTPDRGDIGVMAALNHRESQIRRVAVREASNLCTPSMELVQNPFCGS
FT                   AWRRMGRVLVGYEDYTSFQFSK"
FT   CDS             2266. .2496
FT                   /codon_start=1
FT                   /product="P8"
FT                   /note="movement-related protein"
FT                   /protein_id="AFL55712.1"
FT                   /translation="MDVSSQTTTYDLDPIDSDIPQVKRELSNGRGAQATKRAVARDTAL
FT                   SATRNVTGREVVGGVWTQVAETINNTNHFHF"
FT   CDS             2348. .2677
FT                   /codon_start=1
FT                   /product="P12"
FT                   /note="movement-related protein"
FT                   /protein_id="AFL55713.1"
FT                   /translation="MAGALRRLRGLSLGILRCLRLVMLLVGKLLVVFGHKWPKQSTTRT
FT                   ISISEPLWDNDILIILVLALSFTLIYIFAQQQPIYHHYHTDNNLKTQYITIGTESSKKT
FT                   EQNGA"
FT   CDS             2667. .3725
FT                   /codon_start=1
FT                   /product="P37"
FT                   /note="coat protein"
FT                   /protein_id="AFL55714.1"
FT                   /translation="MALKDERKVKQLAASGVAWAQKLLSGGGWKTLTTPQKKMARQTLG
FT                   MPQAPVAQTGLRVNRVSQPIATASRVKTGEPRVANAKRSMTVTFSEMIGVVKGSSEFQA
FT                   QSWVINPSDVSTFPQLSVSAAMYEKYRFTQLAFRFAPSCPTTTGGVVVMVHDIDSCDDL
FT                   PTDPTMLYEYSGAMRTSSFSPGRLTIPCDGIPRFISDDHSSDPKLIDFGKLVVASYGQG
FT                   ASDPDMVGEIFIEYTCVLIDRQPAALSTQVVSATSNVGPRFTVTMVQGKESPYVLTYTF
FT                   NCGGSFVVSIFYPVSPVYGITSGTASVGTPLGTGLGGEAQIAVVRSPHRGGTITVGLNS
FT                   QSDIPTAFVTRA"
FT   3'UTR           3726. .4019
XX
SQ   Sequence 4034 BP; 1052 A; 896 C; 1051 G; 1035 T; 0 other;

jq807998 Length: 4034  11-JUN-2012  Type: N  Check: 3325  ..

       1  atttggatta cccatgtatt ggttcgagga gttagctctg tgggtgctgg
      51  actcgcgctt cgtcccacta cctatcggtg tcattggagg ggccgtggtt
     101  atatgcaacg tcgcaacgcg tgaagcagcg attgaagccg tttccactgg
     151  aatcaccaat ctcatcgacc acgtagcggg ggcattgagc gtgggtataa
     201  atcccttaga tgaatgcaaa agcttgctta aagtcgttcc actacaccca
     251  agcatggatt ctttattgaa gaatccagtg ctcagcgaag accctgagga
     301  atgtttagaa gtcattcaag ccgatgagaa atcggtgaag aaaagagtga
     351  acaggcactc tcgtggcacg tttgcctccc acgcagccat tgcctgcaaa
     401  atgcattttg gagttgtccc cttgcctaca cgagccaact taacggtggc
     451  cactaggttc gtggccaatt actgtcaaga gaggcatgtg gtgccagccc
     501  acgcacgagg catttgcgac gctgccatcc cgctaatatt cacccctgat
     551  aggggtgaca ttggggttat ggcagctttg aatcatagag aaagccaaat
     601  acgtagggtg gcggtgcggg aagcttccaa cttatgcacc cctagcatgg
     651  agttggtgca gaacccattt tgtgggtctg cttggagaag gatggggcgt
     701  gtcctcgttg ggtacgagga ttacacctca ttccagttct cgaaataggg
     751  gggtctccgg gagatggggg gggtagagac gtcagtctct agaggcaccc
     801  atccccaact taccgtctct cgggaaaaac cagcctcaaa agtgcggaag
     851  atttaccaag ttaccgggct cgacagtggt ttaaacttcg gtgtacacaa
     901  caatagcatc aacaatttgc gccgtggtct aattgaaaga gtattctttg
     951  tcgagtcaaa tggtattttg aaaccaccgc tgaaaccaaa ggtgcacatt
    1001  ttcatgaatc tgagatactt tcgacggcga ttgtgtcata tcgttggacc
    1051  gtataccccg atcgagaggg aggaataccc tctcttgtat cagggcaggc
    1101  gcaaagcgat ttaccaaaac gcattagaaa gtttatcgga taggccttgc
    1151  acaaggaagg acgccaagtt gaagactttt gtgaaagcgg aaaaaataaa
    1201  ttttaccttt aagggtgacc cagcccctcg agtcatacag cctagagatc
    1251  ctaggtataa catcgaggtg ggcaagtacc tgaagaagtg tgagcatcat
    1301  atctatcacg caattgacac aatttgggga ggaccgactg ttttgaaagg
    1351  ttatacggta gagcagcttg gaaacaacat tgctgagacc tggaaccaat
    1401  tccagagacc ttgtgctgta gggtttgacg ccaaaagatt tgaccagcac
    1451  gtttctgtag atgccttgag atttgagcat tctgtctaca atgagatttt
    1501  tcacagtagt gaacttgcta ggttgctctc gtatcagctg cttaattgcg
    1551  gcgttgcggt agcgtctgat gggtttgcta aatacaaggt tgatggatgt
    1601  agaatgagtg gagacattaa cactgccctg gggaattgct tactaagttg
    1651  tgccataact cattatttgt gtaggggcat taagtgcagg ttgatcaaca
    1701  acggagacga ctgtgttcta ttctttgagg agagtgattt gacccttgtc
    1751  aatgatcgtt tgacaaaatg gtccgatttt ggcttctcgg taaagtttga
    1801  ggaaccagtc tatgaactag agaaggttga attctgccag atgcagcccg
    1851  tttggtgcaa cggttgggta atgaccagga acccttacat ttgtacatcc
    1901  aaagatactt acagtatcac gccatggcac aattcagcta gcgcccttaa
    1951  gtgggtggct tctgtgggcg agtgtggact atctttgagt gggggcatac
    2001  cagttcttca gagtttttat agctgtatga tgggattgag tgaacaaagg
    2051  atgaacatca agaatgatgt gtggttttca gatagtggat ttgccagatt
    2101  ggctgctagt ggtcgtcgca ctaaaacaca cattttggag gaaacaagag
    2151  tttctttttg gagggcattc ggtatcttac cggatgcgca gacctccatc
    2201  gaggccgtct atgacgagta cgaaaataat ggagtatttg gtgcgggggg
    2251  tataaacagc gaattatgga cgtctcttct caaaccacta catacgatct
    2301  agatcctatt gatagtgata taccacaggt taaacgagag ttgagtaatg
    2351  gcaggggcgc tcaggcgact aagagggctg tcgctaggga tactgcgttg
    2401  tctgcgactc gtaatgttac tggtcgggaa gttgttggtg gtgtttggac
    2451  acaagtggcc gaaacaatca acaacacgaa ccatttccat ttctgagccc
    2501  ctctgggata acgatatact catcatactg gtattagcac tatcgttcac
    2551  tttgatatat atattcgctc aacaacaacc aatctaccat cactaccaca
    2601  ccgacaacaa cttgaaaacg cagtatatta caattggcac tgagagctcg
    2651  aagaaaactg aacagaatgg cgcttaaaga tgagagaaag gtgaagcaat
    2701  tggcagcgtc gggggttgca tgggcacaga aacttctcag tggtggtggg
    2751  tggaaaacac tcactactcc tcagaagaag atggcccggc aaactcttgg
    2801  catgccccaa gctcctgtcg ctcaaactgg gctccgagtt aatcgcgtct
    2851  cccaacctat agctactgcg tctagagtga agactgggga accaagggtt
    2901  gcgaatgcaa agcgtagcat gaccgttact ttttctgaga tgattggggt
    2951  agtgaagggg tcgtctgagt ttcaggccca atcttgggtc ataaatccca
    3001  gtgacgtttc tacttttcct caactctctg tttctgcggc tatgtatgag
    3051  aaatacaggt tcacccaact cgcgtttcgg tttgctccga gttgccctac
    3101  gaccactgga ggggtcgtgg tcatggtcca cgacatagat tcttgcgatg
    3151  atctaccaac cgaccctacc atgctatatg agtattcagg ggctatgcgt
    3201  actagttcat tctcccctgg gcggttgacc atcccatgtg atgggatccc
    3251  caggttcatt tctgacgacc actctagtga tccaaagctg atcgattttg
    3301  gaaagctagt ggtcgctagc tatggacaag gagcatctga ccctgacatg
    3351  gttggtgaga ttttcataga atacacttgc gtgctgatcg atcggcagcc
    3401  cgctgccttg agcacgcaag tggtatcagc aacatcaaat gtgggaccaa
    3451  gattcaccgt gactatggtc caaggcaagg agtcaccata tgtattaacc
    3501  tacaccttca actgtggcgg cagttttgtc gtttctatct tctatcctgt
    3551  gtcaccagtc tacggcatca ctagtggcac agctagtgtt ggtacacctt
    3601  taggcacagg actaggggga gaagcacaaa ttgcagttgt ccgatcacca
    3651  cacagaggtg gcactatcac tgtgggcctc aactcccaat cagacatacc
    3701  caccgccttt gtgacccgcg cctaagccgg acttacccat ctttctctac
    3751  gggacatcaa tgccctctgg tatagtagcc agttgtgacc tcgtgtgaat
    3801  acgccccaac ttagttggat tctcacgtgc attgggggag aaacaggggt
    3851  aggaagggtt ataggctccg cttggtggag gtcgagaatc ttgtagcgga
    3901  ggttctgacc agttggatgt cccgacgcat aaaatccagg atttatcctg
    3951  gtgggcttgc tagggaaacg ctacaaacaa aactacccca aactgttgta
    4001  aggcagtttg ggggggccca aaaaaaaaaa aaaa