Sequence of DPV Le Blanc nodavirus

Le Blanc nodavirus strain JU1498 RNA-dependent RNA polymerase gene, complete cds.

ACC No: JQ943579

Dated: 2012-10-19 | Length: 3473 | CRC: -314689155

                
ID   JQ943579; SV 1; linear; genomic RNA; STD; VRL; 3473 BP.
XX
AC   JQ943579;
XX
DT   19-OCT-2012 (Rel. 114, Created)
DT   19-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Le Blanc nodavirus strain JU1498 RNA-dependent RNA polymerase gene,
DE   complete cds.
XX
KW   .
XX
OS   Le Blanc nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3473
RX   PUBMED; 23043172.
RA   Franz C.J., Zhao G., Felix M.A., Wang D.;
RT   "Complete genome sequence of Le Blanc virus, a third Caenorhabditis
RT   nematode-infecting virus";
RL   J. Virol. 86(21):11940-11940(2012).
XX
RN   [2]
RP   1-3473
RA   Franz C.J., Renshaw H.A., Wu G., Zhao G., Felix M.-A., Wang D.;
RT   ;
RL   Submitted (16-APR-2012) to the INSDC.
RL   Molecular Microbiology, Washington University, 4920 Parkview, St. Louis, MO
RL   63110, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3473
FT                   /organism="Le Blanc nodavirus"
FT                   /segment="RNA1"
FT                   /host="Caenorhabditis briggsae"
FT                   /strain="JU1498"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /collected_by="Marie-Anne Felix"
FT                   /collection_date="18-Aug-2008"
FT                   /db_xref="taxon:1241918"
FT   CDS             534. .3362
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AFU90716.1"
FT                   /translation="MKELYSDFLTPFQLYVVYFSELLECDFWSWFPQVKEYIDLARQMY
FT                   RSWICHRVPEHLWTNPLIQKWECDVIVYPETWHLRRTIAAIYAFDWWFASHVFLVLLIG
FT                   IPVYFLIHFFQTRKEFLRRDCWIGFRWWMCWLTNATVEGTRFCPSEFGGEADGYRWSTS
FT                   SDGIITWFDGTTTSSMKRLPVANRTCLIAMLPTKIETIRTGYFIQQKWTPVGFSEPRME
FT                   APVLATGEYLTAMETDNEITTVYCSRANTHSGAALTASTWDTVMNALKSAARDTTPYSV
FT                   GAIVRRFYPQINKDRLSEYQSVIAAKWNAEKCPDYVLNETLPEQTLQFVGDRRDDPDAP
FT                   WKATGRGVMPPFCTEPDTMPAKGYQAGISAVTSRLDNCRNPVRHYQQVVLTYCAEFVDR
FT                   VVRRRIQPWTLDDVIDHQDGKLQKIRNAIAKWVAFSWLPTTEVKAMVKIESLANHNFIR
FT                   NISTLPAEFNLSLGSYMLAAAEYMKAEFEWYGAGKTPRAIAERICDMADGAPMDEHRIQ
FT                   WLCAADVSKMDAAKNPSLTAWLTTRIYTRLFGLEDDELITLRKAEASASAATAEGIPYN
FT                   VGASQLSGSACTTIDNTITNAFISYVAHRIQGLTEDVSFQSLGIYVGDDSVSYNTKESV
FT                   EEAGRVLGYKIEAEMIRETDNIPFLSRFFYDAWEGGTSSVQDPVRLLRKLHLSISPTEI
FT                   TTQQAAANKARGIHELDPSIDFYRELYITIRRITGKTGDAMEGLGWMTRQFVSMGGWPT
FT                   DGRANEMWDHYTSFNQSVYIDWLAGVRTWTQFMKGPSQLVFTESKRKAPIMVNPLDPTD
FT                   QLPDEAATDDPPPPQATVGENAEDRPGASDAARMEKSAVAQIDSMVTEERRQEARAAGA
FT                   QQPLVEEERTPAPPPAQTRRERRFGRPAPNPVPPELDPFQNMGTFRPAPARGGFNQRRW
FT                   AARGRPRGRGGR"
XX
SQ   Sequence 3473 BP; 852 A; 965 C; 888 G; 768 T; 0 other;

jq943579 Length: 3473  19-OCT-2012  Type: N  Check: 7460  ..

       1  tgtaaagcgc cacggcttcg ccgtttagct ttcccctttt ggttagagcg
      51  atgtctatag cttgttccct tggttgcggg taacgtagtg atggcaaagt
     101  tggccaactg ggattactgg cgtacgatgt aacagctgga tcgtactggg
     151  ctctgggatc gaccgtctct cttgaggatg ctgcacgctt cgcgcgttag
     201  ggctagagag agcagctcgt ctagtattgt gcaatggtct tgccttgcta
     251  gctaaaacca acccgaattt gatagtacgt gaacgcccgc ccattcatag
     301  cgacaatgat aaactttcaa gccctaatca ctcttcttct tcgttttgtt
     351  tccttggttt ttgatttggc attcttagtg cttcgttata gttttaaggc
     401  tcttatagcc cttattaggc ttggttggct ccttttgcgc ctaccccttc
     451  aagtttgtct ggccgtagct cttttggctt tggccgcagt gatctcatta
     501  gcaaccgccc agcataatac cagctggact gacatgaaag aactctactc
     551  cgatttccta acacccttcc aactctacgt cgtgtacttc agcgaactgc
     601  tagaatgtga cttttggtca tggttcccgc aggtcaaaga atacattgat
     651  ctagctcgtc agatgtaccg ttcctggatc tgtcatcgag tgccagagca
     701  tctctggacc aatccactca tacagaaatg ggaatgtgat gtcatcgttt
     751  atcctgaaac atggcacctt cgccggacaa tagccgcaat ctacgctttt
     801  gattggtggt ttgcgtccca cgtattcctc gtcctcctga taggcattcc
     851  agtttacttt ctgattcact tcttccaaac gcggaaggag tttctcagaa
     901  gggactgctg gattggcttt cgatggtgga tgtgctggct taccaacgcc
     951  acagtcgaag gaactaggtt ctgtccctcc gaattcgggg gcgaagcaga
    1001  cggttaccga tggagcacta gctccgacgg cataatcacc tggttcgacg
    1051  gaacgactac cagttcgatg aagcggcttc ccgtcgccaa ccgaacctgc
    1101  ctgatagcga tgctccccac caagatagaa accatcagaa ccggatactt
    1151  tatccaacag aaatggactc ccgtcggttt tagcgagcca cgcatggagg
    1201  ccccggtttt ggctacgggt gaatatctga cagcaatgga gaccgacaac
    1251  gaaatcacca ccgtctactg ctcaagagcc aacacgcact ctggcgccgc
    1301  tctgactgct tccacttggg atacggtcat gaacgcgttg aaatctgctg
    1351  cccgtgacac aacaccatac tccgtaggag caatcgtgcg cagattctac
    1401  ccccagatca ataaggacag actttccgaa taccaatccg tcatcgctgc
    1451  aaagtggaat gcagaaaagt gtccagacta tgtcctgaac gaaactctcc
    1501  ctgaacagac tctacagttc gttggggatc gacgagatga tccggacgcg
    1551  ccatggaaag ccacaggacg aggcgtcatg cctccgttct gcaccgaacc
    1601  ggacaccatg ccggccaaag gctaccaagc aggaatatcg gccgtaacaa
    1651  gccgattaga caattgtcgg aaccccgtcc gccactacca gcaagtcgtc
    1701  ttgacgtact gtgctgagtt cgtcgatcga gtagtccgca ggcgtattca
    1751  gccttggact ctcgatgacg tgattgacca ccaggacggc aaactccaga
    1801  agatcaggaa cgcgatagcc aagtgggtcg ctttctcatg gctcccaact
    1851  acagaagtca aagccatggt aaagatcgag tcactggcca accataattt
    1901  tatccggaac atttccaccc tccccgccga attcaatttg agcctcggta
    1951  gttacatgtt agctgccgca gagtacatga aggccgaatt tgaatggtac
    2001  ggggcgggca agacgccaag ggccatcgcc gagcgcatat gcgatatggc
    2051  tgatggagcc ccaatggatg agcaccgaat tcaatggctc tgtgccgcgg
    2101  acgtctctaa gatggacgca gctaagaacc cgtcgctcac cgcttggctc
    2151  acaacccgga tatacacgag gctgtttgga ttagaggacg acgagctcat
    2201  cacgctcagg aaagctgaag cttcggcatc cgctgcgacg gccgagggca
    2251  tcccctacaa tgtaggagct tcccaacttt caggaagcgc ctgcaccacg
    2301  atcgacaaca cgatcaccaa cgcattcatc agttatgtag cacaccgtat
    2351  tcaaggactt acggaagatg tcagctttca aagcttaggc atctacgtcg
    2401  gagacgattc ggtgagctac aatacgaaag agtccgttga agaagcaggg
    2451  agagtgctcg gctataagat cgaggcggag atgatccgtg aaacggataa
    2501  catccccttc ctatccaggt ttttctatga tgcctgggaa ggtggcacca
    2551  gttccgttca agacccggtc cgactattga gaaaactcca cctctctatc
    2601  tcacccacag aaatcacgac gcagcaggca gctgccaaca aggcgcgagg
    2651  gattcatgaa cttgacccga gtatcgattt ctaccgcgag ctctacatca
    2701  caatccgacg catcaccggc aaaacgggag atgctatgga aggattgggt
    2751  tggatgactc gccaatttgt gagtatggga ggttggccga cggatggacg
    2801  agctaacgag atgtgggacc actacacgtc cttcaaccaa tcagtctata
    2851  ttgactggtt ggctggagtc cgcacctgga cccagttcat gaaaggccca
    2901  tctcagctcg tcttcacgga atccaagagg aaggcgccaa taatggtaaa
    2951  ccccttggac ccaacggacc agctgccgga cgaggcagcc acggatgacc
    3001  cccctccacc acaagcaacg gtaggagaga atgccgaaga taggcctgga
    3051  gcgtctgacg ccgcacggat ggaaaaatcc gcagtggccc agatcgactc
    3101  tatggtcacg gaggagcgcc gccaggaagc tagagctgct ggggcccaac
    3151  aacccctggt ggaagaagaa cgcacaccag ctcctccccc cgctcaaaca
    3201  aggcgtgagc ggcggttcgg ccgaccagcc ccgaaccctg tacctccgga
    3251  actagatcct ttccagaata tgggaacgtt ccgaccggca cctgcgcgcg
    3301  gtggtttcaa ccaacgccgc tgggctgccc gtggaagacc tcgaggtaga
    3351  ggcggtcgct agacgtagcg tctagcataa tagtctctgt tcgacattaa
    3401  atgtcagcgt tgagggaagc aacgacaaaa cggacacctg acgaggtgtc
    3451  cggccccttc cccctagggg cac