Sequence of DPV Le Blanc nodavirus

Le Blanc nodavirus strain JU1498 capsid protein and delta protein genes, complete cds.

ACC No: JQ943580

Dated: 2012-10-19 | Length: 3001 | CRC: -888740755

                
ID   JQ943580; SV 1; linear; genomic RNA; STD; VRL; 3001 BP.
XX
AC   JQ943580;
XX
DT   19-OCT-2012 (Rel. 114, Created)
DT   19-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Le Blanc nodavirus strain JU1498 capsid protein and delta protein genes,
DE   complete cds.
XX
KW   .
XX
OS   Le Blanc nodavirus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Nodaviridae;
OC   unclassified Nodaviridae.
XX
RN   [1]
RP   1-3001
RX   PUBMED; 23043172.
RA   Franz C.J., Zhao G., Felix M.A., Wang D.;
RT   "Complete genome sequence of Le Blanc virus, a third Caenorhabditis
RT   nematode-infecting virus";
RL   J. Virol. 86(21):11940-11940(2012).
XX
RN   [2]
RP   1-3001
RA   Franz C.J., Renshaw H.A., Wu G., Zhao G., Felix M.-A., Wang D.;
RT   ;
RL   Submitted (16-APR-2012) to the INSDC.
RL   Molecular Microbiology, Washington University, 4920 Parkview, St. Louis, MO
RL   63110, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3001
FT                   /organism="Le Blanc nodavirus"
FT                   /segment="RNA2"
FT                   /host="Caenorhabditis briggsae"
FT                   /strain="JU1498"
FT                   /mol_type="genomic RNA"
FT                   /country="France"
FT                   /collected_by="Marie-Anne Felix"
FT                   /collection_date="18-Aug-2008"
FT                   /db_xref="taxon:1241918"
FT   CDS             300. .1349
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AFU90717.1"
FT                   /translation="MTTSNSIILKGCDRIVTVVDASTLSAGDPLVKLMITPDIAYRLGA
FT                   TAKTFQRIKYKTMRFRVNAQCATTTAGGYVAGFVKDAGDELPTGDRAVPYLMSNTGSFT
FT                   QPWWKSTVHNVKLPQKMFYTEKPAVGSDAVREYSPGTFYVVVDSKPSQVCPVTVDLEWA
FT                   VELHDATYREVEAVTTISGISADYSLNVFGIPATSVLAGRILITPKGSNPRPLTIERFR
FT                   TFFGFAPDLMFCVRLPRPEDVVLTGDNVYQGVKATHFMAYTADGLLDFHLAAFNDVTQS
FT                   IIPVRPSDWRVYSVDGSSSTPFTSAIYENTTWSSDDKFVPVTISDVPIPGAVFRFLYPS
FT                   VGYSLPSSN"
FT   CDS             1469. .2665
FT                   /codon_start=1
FT                   /product="delta protein"
FT                   /protein_id="AFU90718.1"
FT                   /translation="MIASLQAAEIHLGRPTASYEQWFNETIGTTLTKLADNSDRMIELV
FT                   EKLSSCVVDEQLAITTRETLKVEVENKVPVTVENTPRVHVDNEVDVTVKNEALRVRNYM
FT                   LKLEEIEFPEPLFVLGAEKDIEGHPKKFECEVINEPTVKLAGGTSIDTNVVNTVDCNIV
FT                   NEPIVRLADDSHVDAVVTGTVNCNVLNEPTVHLAANSRVDAFVGNTVFTSVVALPEVHV
FT                   GSLPGVDVIALPPVSLSANPLPVTVTGGTLTIDQPVSVIAEVPLEVYMSNEVAVKVIEV
FT                   EGTVDVAVKNRFSDPIPVCQLTRTLVPAPPATNNYSGQGVFRELSQSHPLPMYQVGPDN
FT                   GISHTMGPQNTTFVRDVSEDGYVWSDCQNSRLPDVYKHEFEGEDRRRTVLAVVAEAHS"
XX
SQ   Sequence 3001 BP; 754 A; 794 C; 739 G; 714 T; 0 other;

jq943580 Length: 3001  19-OCT-2012  Type: N  Check: 9754  ..

       1  atcgaaccaa cagcatcgca atccaggacg ggactcgcac cctctctggt
      51  ctatggcctc aatcgtaaag cgctaaagga cccacgtccc agctttatga
     101  gcgtggcgca ctcctcccat acggatttat ctcgggagac aggctatggg
     151  gttcgcaccc ccatagttta gccctgaccg ctaacaaaca ccgcacacat
     201  aaatcaaacc ggagaggaaa accggtgaaa caacctcatt ctcgccgttc
     251  taacaggaat ggaaataccg caccagtagc ccgtgcaaac ccgctacgta
     301  tgaccacgtc gaattcgatc attctgaaag gatgcgaccg aattgtgact
     351  gtggtagacg cttcgactct ttcagctggc gacccgctcg ttaagctgat
     401  gattactccc gatattgctt accgtctagg agcgactgca aagacgttcc
     451  aacggatcaa gtacaagacc atgagattca gagtcaacgc tcaatgtgcc
     501  actacgactg ccggaggtta cgttgccgga tttgtgaagg acgctggaga
     551  cgaactgcct actggagaca gagcagtgcc gtatctcatg tccaacacag
     601  gttcatttac ccaaccctgg tggaaatcga cggtccacaa cgttaagtta
     651  ccacagaaga tgttctacac ggagaaacct gccgtaggca gtgacgctgt
     701  acgtgaatat tcccctggaa ccttctatgt tgttgtggac agcaaaccta
     751  gtcaagtttg tcccgttaca gttgatctgg aatgggcagt cgagctccat
     801  gacgcaacct accgtgaagt agaagcagtc accaccattt ccggaatctc
     851  agctgattac tctctgaacg ttttcggaat tcctgccacg tccgtgctcg
     901  caggccgtat tcttattaca ccaaagggta gtaaccctcg tcctttgacc
     951  atagaacgat tcagaacatt cttcggcttt gcgcctgatt tgatgttctg
    1001  tgtccgacta ccaagacctg aggatgttgt cctcacaggg gacaatgtct
    1051  accaaggagt caaagcaaca cactttatgg cctacacagc agacggactc
    1101  ctcgacttcc atctcgcagc tttcaatgac gtcacccaat caatcatccc
    1151  tgtaagaccc tcagactgga gggtgtattc ggttgatgga tctagttcca
    1201  cgccattcac ctcggccatc tatgagaaca ccacttggag ttctgacgac
    1251  aagttcgtcc cagttaccat ttcggatgtg ccaattccag gagccgtgtt
    1301  ccggttcttg tacccatctg taggttattc cctgccatcg tcaaactagg
    1351  atggggcaac gtcgtgcagc tgacggagcc caatcttttg tttcgcacat
    1401  ggtttgagaa ccaacagctg gtcctaggac ttccatccga ggattatgct
    1451  acttggtttg ccagggccat gattgcctca ctgcaagctg ctgagatcca
    1501  cctcggccga ccaaccgcta gttatgagca gtggtttaac gaaacgattg
    1551  gaaccacttt gaccaaactg gccgataact cggacagaat gatcgaactg
    1601  gttgagaagc tctcttcatg tgtggtcgac gaacagttgg ccatcactac
    1651  aagggagact ctcaaagtcg aagtggagaa taaagtgcct gtaacagtcg
    1701  aaaacacacc gcgtgtccac gtagacaacg aagtcgatgt aacagtcaag
    1751  aacgaagctt taagagtacg gaattacatg ctgaaacttg aggagatcga
    1801  gtttccagaa ccgctgttcg tactcggagc cgagaaggat attgaaggac
    1851  acccaaagaa atttgagtgc gaggtcatca acgaaccaac tgttaaacta
    1901  gcaggaggca cctcaataga caccaacgtt gttaacactg tcgattgtaa
    1951  catcgtcaac gagccgatcg tcagattggc tgacgattcc cacgttgacg
    2001  cggtcgtgac cggcactgtt aactgtaacg ttctcaatga accgacggtc
    2051  catttggccg ccaactcgcg tgttgatgct ttcgtcggca acacagtttt
    2101  cacttctgtg gtggctctac ctgaggttca tgtggggtcc ctaccaggtg
    2151  ttgacgtgat agcattacca ccggtgtctc tttctgctaa tccgctcccc
    2201  gtcaccgtta caggaggtac gctaacaata gaccaaccag tgtctgtaat
    2251  cgctgaggtc ccattggagg tgtacatgag taatgaggtc gccgtaaagg
    2301  tgattgaggt tgaggggaca gtcgatgtcg cagtcaagaa taggttcagc
    2351  gaccctattc cagtctgtca gctcacacgt actctagttc cagcaccccc
    2401  agccacgaat aattattctg ggcagggagt gttccgtgag ctctcccagt
    2451  cgcatccgtt gccgatgtat caggtaggtc ctgacaacgg catttcccac
    2501  actatgggtc cgcagaacac tacgttcgtg cgcgacgttt cggaagacgg
    2551  atatgtctgg tcagactgcc agaatagcag gctacccgat gtctataagc
    2601  atgagtttga aggcgaagac cgcaggagaa ctgtcctcgc ggtagtcgcc
    2651  gaggctcatt cttaggtagc atgttgttcg actagttgat actccttctg
    2701  gtcagttatc gtcctacacg tgggtaggac gcaccatcta ggtggtgatc
    2751  ccggttggca accaaaatgg ataacgggta ttcaaacaca agaattaaac
    2801  aaggtgtcgg ccagtcctgg tcgtaatgta gtaggtccgc caaacctgcc
    2851  acactggaca cgcctgctag cttgctagcg aacccggtga ctccgaggta
    2901  ttactggtag cctctgttcg gcattaaatg tcagcgttgt ggggattcaa
    2951  cgacaaatgg tgggtttcgt caaccctcca ggccaatccc tcttgggccg
    3001  c