Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate T68-1, complete genome.

ACC No: JQ965169

Dated: 2012-07-18 | Length: 19246 | CRC: 310078574

                
ID   JQ965169; SV 1; linear; genomic RNA; STD; VRL; 19246 BP.
XX
AC   JQ965169;
XX
DT   18-JUL-2012 (Rel. 113, Created)
DT   18-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate T68-1, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19246
RA   Hilf M.E., Harper S.J., Dawson W.O.;
RT   "Citrus tristeza virus: strains, genotypes and isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-19246
RA   Hilf M.E., Harper S.J., Dawson W.O.;
RT   ;
RL   Submitted (23-APR-2012) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Stn Road, Lake Alfred, FL
RL   33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: BioEdit v. 7.0.5.3
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19246
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus macrophylla"
FT                   /isolate="T68-1"
FT                   /serotype="MCA13+"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="01-Mar-2003"
FT                   /note="genotype: T68"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9449
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /note="p349 protein"
FT                   /protein_id="AFN61253.1"
FT                   /translation="MSKLGASFRSSAFAVRSDYTISRIWRAFNAIGVLHFFGDGKITKV
FT                   IKEFSAAGPIVPLRKSCFPFTVRAAVRAIRAAGRPIDAPRSGCLCGLPVFDASGVVRPR
FT                   SVAGVWRFSLCKPPLTTAAKRSLRKAKKDSVSFPSRASSLFSRRVPRGMRRRLRRRVMN
FT                   RVNPTVHESPQDKNRNKGRQHGKASALPYMGEAALEDILRWIEEVNPPASMVAVPVPIL
FT                   FGALPTTAWCSPSDAAVLQCRLDYHAAETSFHSEEKHVRYVYNDVSSAAHRPRTVSPRK
FT                   CGRVFPSNSVLGVETPTGRDAHTAFVRSTHVGVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVCYYRPGPNGTVSVFMSDGANTARLDVVAPAYYAYAKALGAKARCLWESSDLDDAKV
FT                   RDGQCYVRHVYDVALYYGRRVDLSMCRTLGMYPTVGALKVFLTREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKQWVDLRTIPNHHLVGGNSAQILIGQIRVDVAGSVAKPSRSAIRRRNR
FT                   RLRKDGFIGSSESSSSGWSRHCSDCSTPRAPPSPSVLKPNLGRIPSINRKFRYPVGTQL
FT                   SVSIPKRADDRVYVSIGQDFDDLCHSVCTYVKRYNSRKSFYTRFENGEDFIILRRASVG
FT                   GLHVFTKRGSCTARFPLTASRYEAKYDEYMKDYDLSWVKKDRHLDVEVIRRRRSGVSRR
FT                   SAGSPSVDTRVSSDQQSEPTETVPTLVEDYSPCRDALSSQPGVGSAWFKVNSPNRCART
FT                   VRERHSTNKGKIGDFDFPRGTVYNAHVDESAYKRVLKLRDTSASSFLRIVLARLSSYRP
FT                   LSDEFFNKCVTSRFVVCVEAVESGLVTVHFRSDVFRASFPFGVHLYTRHAFDIYSGKLL
FT                   ALDTYGFSEDLRDGYCYIRHIAEVCLSMGRIFFRRDVNLGAYPYVFEVQHRLERLYGKL
FT                   ALKYGVRGYYSASRLYHCSYSDSPRPMKLLNKYHKMGGEDGPLLITDTDRLRAVGSAYE
FT                   KVKGRLPDSLLVRSVEKDLIEFNQTLVDAQRARPGVVVPFQMSENQQVMLTRAYPEFNI
FT                   NFTHSVHSDHPVAAGSRALENHLVRKYAGGDYSDVGGCPLFHLRAGHSGVHVCRPVYDI
FT                   KDAHRRVIRHHQLGRVELNHTDGSKQVGAVNTNSVCGNVLGECFHASDAIVMVQVYDVP
FT                   LRELCRAMINKKASVCYMTVVTPGELLDARESFFVKELDCSVELDTVADKVVYCFNNSA
FT                   YTHTYSTIREYMCTPCVVVDGFLFTVEMVSLRCSVNYYCITKSRVCPRISETKRLRYRR
FT                   CDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTWNY
FT                   IKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVRGRQNAEAFSRRLAAFSGDTS
FT                   LFELVMFAISEKCRDLFVGVQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELDVP
FT                   VDLPGFGSMTEGDEAKLIEDGVKSALLRKAVQDEARLIIGQGGTSEIVPRGDDGESGGD
FT                   NSDRSHKADSDSTSSASSGGLRAGAAPSLFRCLLKKLGGGFCLARKILDLLCEKVIRSF
FT                   SQLKCSTFRLTSFLNTLRAKFSCHFFDDSIFVTVWEIILNLFRIVNGVTKTKLGCLRNV
FT                   FRLIPRLYSGCKDFVKTVGDMYKDIALFSAEFFSKSYAKLCRFSLEVFDVGLIEISARN
FT                   LGLETCVSLASAVFDILLTYPLGNISFPIVCARVFGALAMEIGTNYSFKRTLGKPEVLG
FT                   EDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGIIPGVLRIVLSSLFSDVDTWVGYCKHE
FT                   VSSLPTVTFCVKRLSHLLEQVKEACIAYIVDSSKKIITSLTSEFHESLHNSELTSGARS
FT                   LYNQLSTIISKSSDVIGRAGNAVASVKAAGSSLSKRVRRIRPPYPLVRCVDEQTSEYYS
FT                   ATDSSELDEALLSDAPGLRGNGRCADLLRVVIRRVVMYRRRAVDGLSCLVLRIGDHSYS
FT                   CVMDTFMRLFVKLNVVISECKRLTADSVAKASELAVGCLSWCNLRFGANSSAPGLPGGS
FT                   GGSAFSLLEHCLKCVIDLFINMWSSVFDENFYSSLVHRLRITSVNVLLEFLKNLPVCLV
FT                   WIYTFIECRSRVFPLKEFLWGFCVFVRNIIRELSLNIYGNLPFCVTRLCDRVFRRRLNE
FT                   DDTRTLQVITEAENRVAFLREVLAEMSRYRASLEVPLPASPDSPLFPPTYGEIEELGTG
FT                   SSDNARVIGVDDGSDSATTEGETNSVSDGDSDVSLPLDRDFEQIGGLGGNGNVDVCRLG
FT                   LRFLYRVSRNAFSMKAVRFLYGLVLQSVFKGGSVSDFLSRVLFSLGGCLPFEFFRSVCA
FT                   ARWLSKRWALRVRNANVCDEETVEYLFSFSRLLYDSRYLSSVFSLLEKVDFYLSYSFSL
FT                   PKRYFTTNRTVQLRVRAPVRVVSAAEPVRDSGKSLAEILNSLDSLKTPTCKGKSTVVES
FT                   DDSDSDSSRSTGSILFGSVNGEVMSAVNGDGVCEKAPLMKHAAALSELEPDASGRKNLP
FT                   IVRRKFTRGESSGTKSAGSVCVYLTTLNSSFGSVPDLYPVARDIEYKKLTNAIREFYYS
FT                   QKVTLYELHGKLSSYWDELKAVGFDRKLTKMDLDEDVNVVDFSSKVLIGRNGSRPFRNT
FT                   VNSHEFMFCDDGLVPCPGSKKRDFALISSQTSFVAANSFLRAVDGKDLTFTNSGHSLIV
FT                   YEAPPGGGKTHSLVKYFSDYCTKVSCLVVTANKNSQAEISQRISKELMDRKMVAKHVIK
FT                   TASRVFTVDSYLMNHIHLKTELLFVDECFMVHAGAIGAIVEFTSCKAVVFFGDSRQIHY
FT                   IHRNDFGVSLLHDIDAFIQPEHRVYGEVSYRCPWDICEWLSKFYPRHVATANIASVGKS
FT                   SVSIEIINGYDDVPYESDAKYVVYTQAEKNELQKHLGRLTVGRTKIVPIVNTVHEVQGE
FT                   TYKRVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLVYSVLNSRRYDKTASSIDEAREIF
FT                   DKFRSANHSHGSSSLEWYLEKYPNEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGDTS
FT                   EELSSQPFESGCDNVTIRDTAPPDSGNLHEPARVRRGKVTGNSAKKSVSTRKSSVIRKS
FT                   "
FT   CDS             <9376. .10806
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /note="start codon not determined; likely expressed by +1
FT                   ribosomal frameshift"
FT                   /protein_id="AFN61254.1"
FT                   /translation="VVRSQAIPPRKASLQENLLSYESRNYNFIKTERYVGPENFGRAMA
FT                   AAVLDRCFKMEEVAKIRSDIIALTEANIAKWLDKRTPCQVKSVQAELKLPFAAEEQITN
FT                   YKLMVKRDAKVKLDDSCLSKHPAAQNIMFHKKFINAIYSPCFDEFKNRVLSSLNRNIVF
FT                   FTEMTNAGLAEVIRRIIGDDDDLFVGEVDFSKFDKSQDLFIKEYERSLYSEFGFDDELL
FT                   DLWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSRFELLL
FT                   ISGDDSLIYSRAPISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFIPDPYK
FT                   LLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLKFLVEAKYGFTSGTTMPAL
FT                   CAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFADLICERAVYDNRAGYFSYFDN
FT                   PFTKPDASDGQADDLATG"
FT   CDS             10855. .11766
FT                   /codon_start=1
FT                   /product="p33 ORF"
FT                   /protein_id="AFN61255.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYSGDVVGDFTIDVGYNAADR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTHKIRAHVDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPAPTRGYYSFRTFVSGDIASERSEFMCSFVGSRYLCCCTQTISENL
FT                   STVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPHPPRCYRNNNLG
FT                   DSSGVQSRTIEEEGYRTDTVSNVTVTIPNTPLVNAVSPYVAEFNENTRSRVSLIRRVCC
FT                   YAVCVLVVSLLIMSGLIAIIFI"
FT   CDS             11836. .11991
FT                   /codon_start=1
FT                   /product="p6 ORF"
FT                   /protein_id="AFN61256.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATI"
FT   CDS             11997. .13781
FT                   /codon_start=1
FT                   /product="p65 ORF"
FT                   /protein_id="AFN61257.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLATSGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVVCSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTVDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERRLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13705. .15321
FT                   /codon_start=1
FT                   /product="p61 ORF"
FT                   /protein_id="AFN61258.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNISLDHTLSSG
FT                   VVVRRQNLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKIPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGKLLSSTEIDTYKTMVFT
FT                   KTFDSGVLGVTTKLEMYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   YTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLVPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAVDRVVERPALFNLPRKLLNQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRVYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSVTPPPFNRHRRGSSRILGGGGARGASSRYMSRE
FT                   GATSGFNLPFHHGGLHDASQN"
FT   CDS             15290. .16012
FT                   /codon_start=1
FT                   /product="p27 ORF"
FT                   /note="minor coat protein"
FT                   /protein_id="AFN61259.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16104. .16775
FT                   /codon_start=1
FT                   /product="p25 ORF"
FT                   /note="major coat protein"
FT                   /protein_id="AFN61260.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16741. .17244
FT                   /codon_start=1
FT                   /product="p18 ORF"
FT                   /protein_id="AFN61261.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DMLNSFSAISNCAIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGINVDDSRCGCSIWFYNNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17278. .17637
FT                   /codon_start=1
FT                   /product="p13 ORF"
FT                   /protein_id="AFN61262.1"
FT                   /translation="MGIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDAHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDS"
FT   CDS             17713. .18261
FT                   /codon_start=1
FT                   /product="p20 ORF"
FT                   /protein_id="AFN61263.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18344. .18973
FT                   /codon_start=1
FT                   /product="p23 ORF"
FT                   /protein_id="AFN61264.1"
FT                   /translation="MNDTSGQTFISVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPNINAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18974. .19246
XX
SQ   Sequence 19246 BP; 4720 A; 3842 C; 4944 G; 5740 T; 0 other;

jq965169 Length: 19246  18-JUL-2012  Type: N  Check: 8195  ..

       1  aatttctcaa attcacctgt accctccgga aaatacgtcc ggacgctgca
      51  ggatttggtg taggtccagc cttaggctca gctaccccca tacaaaccta
     101  attatacatg tcgaaacttg gagctagctt caggtcctcg gctttcgctg
     151  tacgcagcga ttatactatt tcgcgcatct ggcgcgcttt taatgccatt
     201  ggagtcctgc acttctttgg cgatggtaaa atcactaagg tgattaagga
     251  gttttcggct gctgggccga ttgtcccatt acggaaatcc tgttttccgt
     301  ttactgttcg cgctgctgtt cgcgcgattc gtgccgccgg acgtcccatt
     351  gacgctccgc gctctgggtg cctctgtggt ctccctgttt tcgacgcatc
     401  tggcgtcgtg cgtccccgct ctgttgcggg cgtttggagg ttttctctgt
     451  gcaagcctcc cctaactact gccgctaaga ggtccctccg taaggcaaag
     501  aaggattctg tttcctttcc tagccgggct tcttcactct tctctcgaag
     551  agtccctcgc ggcatgcgtc gtagacttcg ccgacgcgtg atgaaccgag
     601  tgaacccaac cgtgcatgaa agtccccaag acaagaacag aaacaaggga
     651  cgccagcatg gcaaggcttc tgccctcccg tacatgggag aagcggcgtt
     701  ggaggacatc cttcgctgga ttgaggaggt taaccctcct gcttcgatgg
     751  tcgccgtccc ggtgcccatc ctttttggag cattgcccac tacggcttgg
     801  tgctcccctt ctgatgcagc ggttttacag tgtcgtctag actaccacgc
     851  tgcggagact tcttttcact ctgaggagaa gcatgtgagg tacgtctata
     901  atgacgtttc ttcggccgct caccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgtg tctttcccag caattctgtg ctgggcgttg agaccccgac
    1001  cggtagggat gctcacaccg cctttgtgag atctactcac gttggggtgt
    1051  ttttctctga cgcggttcgc cgcgttcgta tgttccgtcc tggacggaat
    1101  aattttttca ctagcgtcgt cagtgggcgg cgagtttgtt actatagacc
    1151  cgggcctaat ggcacggtgt ctgtctttat gtccgacggc gccaatacag
    1201  cgcgtctcga cgttgtcgct cctgcgtatt acgcgtacgc taaagctttg
    1251  ggtgccaaag ctcgttgctt gtgggagtcg tctgacttgg acgacgctaa
    1301  agtgcgtgac ggtcaatgtt acgttcgtca cgtgtacgac gtggctctct
    1351  attatgggag gcgcgttgac ctttctatgt gccgcacttt gggtatgtat
    1401  cccacagtgg gtgctttaaa agtttttctc actcgcgagt atggtcgcga
    1451  ttctttaaag gttccaatgc gcgggaccta cacctttggt agtgtttttc
    1501  actgcctgtc gaccaaacaa tgggtcgact tgagaactat tcctaaccac
    1551  catttggttg gtggtaactc tgctcaaatt ctaatcgggc agattcgtgt
    1601  cgacgtcgct gggagcgtcg ctaaaccgtc ccgatcagcc attcgtaggc
    1651  gtaacaggcg cctgcgaaaa gatggtttta tcggcagttc cgagtcctct
    1701  tcgtcggggt ggtcgaggca ctgttcagac tgttctactc ctcgcgctcc
    1751  gccctctcct tcggttttga aacccaatct cggtagaata ccgagtataa
    1801  accggaagtt ccgatacccg gtgggaactc agctgagcgt ttctatccct
    1851  aaacgtgctg atgaccgggt gtacgtgtca atcggtcagg attttgatga
    1901  tttgtgccac tcggtttgta cctatgttaa aaggtataat tcgaggaagt
    1951  ccttctatac gcgttttgaa aatggtgaag attttatcat tcttcgacgc
    2001  gcttccgtcg ggggcctcca cgtgtttacg aaacgtggta gttgtacggc
    2051  tcgttttcct ttaacggcct cgaggtatga ggctaagtac gatgaataca
    2101  tgaaagacta tgatttgtcg tgggttaaga aggatcgcca tcttgacgtt
    2151  gaggtgatac gccgtaggag aagcggtgtt agtcgtcgtt cggctggctc
    2201  tccgagtgtg gacacacgcg ttagttctga ccaacagtca gaaccaaccg
    2251  agactgttcc tacgctcgtt gaagattatt cgccgtgtcg cgacgccttg
    2301  tcgtcgcaac ctggtgttgg gtcggcttgg tttaaggtaa actccccaaa
    2351  tcggtgtgct cgcaccgttc gtgaacggca ttctaccaac aaagggaaga
    2401  ttggggactt tgatttcccg aggggcaccg tgtacaacgc acatgtcgat
    2451  gagagtgctt ataaacgggt gttgaaattg cgggatactt cggcgtcctc
    2501  ttttcttcgc atagttttgg ctcgtctgtc gagttacagg cctcttagcg
    2551  atgagttttt caacaagtgt gtcacatctc ggtttgtggt gtgtgttgaa
    2601  gcagtggagt cgggtcttgt tacagtgcat tttcgctccg atgtttttcg
    2651  tgcgtcattc ccgtttggag tgcatttata tactcgtcac gcgtttgaca
    2701  tttacagtgg taaactactg gcgttagaca cctacggttt ttctgaagat
    2751  ctgagagatg gttattgcta tattcgtcac atcgccgaag tttgcttgag
    2801  catggggagg attttcttta ggagggatgt caacttagga gcgtatcctt
    2851  atgttttcga ggtgcagcac cgtctcgaga gattatacgg caagctagca
    2901  ctgaagtatg gtgttagagg ttattactcg gcgtcgcgtc tctaccactg
    2951  tagctacagt gattcaccga ggcctatgaa attactcaat aagtatcata
    3001  agatgggcgg tgaagacgga ccgctgttga ttacggatac ggacagactg
    3051  cgagccgtgg gtagcgccta tgaaaaggtg aaagggcgtt tgcctgattc
    3101  gctgcttgtt cgatcggtag aaaaggattt gatagagttc aaccaaactc
    3151  ttgtcgatgc gcagcgagct agaccgggcg ttgttgttcc ttttcaaatg
    3201  agtgagaacc aacaggtgat gctcactagg gcttaccccg agttcaacat
    3251  aaactttact cattctgtgc actccgatca cccagtggcc gcgggttcta
    3301  gagcgttgga aaaccacctc gttcgtaaat acgccggcgg tgattactcg
    3351  gatgtggggg gttgcccgtt atttcacttg cgtgcgggtc attctggtgt
    3401  gcatgtgtgt agaccagtat acgatattaa ggacgctcac cgtagggtga
    3451  ttcgccacca ccagctcggt agagttgagt tgaaccatac tgacggttcg
    3501  aaacaggttg gtgcggttaa cacaaactcc gtatgtggta acgttttagg
    3551  ggaatgtttt catgcgtctg atgcgattgt catggtgcaa gtttacgatg
    3601  taccgctacg tgaactatgc agagctatga taaacaagaa agcctcggta
    3651  tgttacatga ccgtggttac gcctggcgag ttgttggatg ctcgcgagtc
    3701  cttcttcgtt aaggagttag actgttcagt ggagttggac accgtcgccg
    3751  ataaggtcgt ttattgtttc aacaattcag cgtatacaca cacctactct
    3801  acgatacgcg agtacatgtg tactccttgc gtcgtagttg acgggttttt
    3851  gttcacagtg gagatggttt cgttgaggtg tagcgtgaat tattattgca
    3901  tcactaaatc gcgagtttgt ccgagaatta gcgagactaa acggctgcgt
    3951  taccgtcgat gcgacagtga tttaattagg attaaaatcc ctcggtattc
    4001  tagtaaaact cgtagttgtt tacctgggtg ttattatctg tacttagacg
    4051  ccaagtttgt aagtcgcgtg tacgagtacg tggttaataa ctgcgtagtg
    4101  gtgaatgcta aaactttcga atggacttgg aattatatca agtcttgtaa
    4151  gtcgagggtg gttataagcg gtaagatcat ccatagggat gtgcccatag
    4201  ctttggagta tttggacggg ttttccgccg ttatgttgtc tgcaggtgtg
    4251  agaggtaggc aaaacgcgga ggcgttttcg agacgtttgg ctgcgttctc
    4301  aggtgacacg tcgcttttcg aattggtgat gtttgctata tccgagaagt
    4351  gtcgcgactt gtttgttgga gttcaggagg ctgtggagag gtgcgtaaaa
    4401  tcgtacctta ggaactcgtt taacatgagc tttgtggatt tgtccgatcc
    4451  cttgcttacg attagtgagt attccgaatt agacgttcct gttgatttac
    4501  caggttttgg tagtatgacg gaaggtgatg aagctaaact tatagaagac
    4551  ggggtaaagt cggctttact gcggaaggcg gttcaagatg aagcacgatt
    4601  gattatcggg caaggaggta cgtccgaaat cgtccctcgt ggtgacgatg
    4651  gggaatcagg cggcgataat tcggaccggt cgcacaaggc cgacagcgat
    4701  tctacctcta gcgccagttc cggaggcttg cgagctggag ccgctccttc
    4751  gttgttcaga tgtttgttaa agaagttagg cgggggattc tgtctagcca
    4801  gaaaaatact ggacttgttg tgcgagaagg tgataaggtc cttttcgcag
    4851  ctaaagtgca gcacctttcg gttaacttcg ttccttaaca cgttgcgcgc
    4901  taagttttct tgccatttct ttgacgattc aattttcgtc actgtctggg
    4951  aaattatctt aaatttgttc agaattgtta atggggtgac taagacgaag
    5001  ctggggtgtc ttcgtaacgt gtttcggctg atacctaggt tgtattctgg
    5051  ttgtaaagac tttgtaaaga ctgttgggga tatgtataaa gacatcgcgt
    5101  tattttccgc ggagttcttt agtaaaagtt acgccaagct atgtcggttt
    5151  agtttggaag tgtttgacgt ggggcttatt gaaatttctg cccgtaattt
    5201  gggactagag acttgcgtgt cgctggcttc agccgttttt gacatcctac
    5251  tcacctaccc cttggggaat atcagttttc ctattgtctg cgcgagagtt
    5301  ttcggtgctc tcgctatgga gatagggaca aattactctt ttaaaaggac
    5351  tttgggtaag cctgaggttc tgggagagga cgcttttcgt agaaccgtaa
    5401  gtatggtgtt aagtgctaaa gcctttgata agctttccgt cgacgctaag
    5451  ggtttggtta ggtgttctgg tatcattcct ggggtattga gaatagtact
    5501  ttcgtctcta ttctctgatg ttgacacatg ggtaggttac tgtaaacacg
    5551  aggtttcttc acttcccacg gtcacatttt gtgtgaagag gctatctcat
    5601  ctgttggaac aggttaaaga agcgtgcatc gcttacattg ttgattcttc
    5651  taagaaaatc ataacatctt taacttcaga atttcacgag tctcttcaca
    5701  actcggagtt aactagtggt gctagatctt tgtataatca attgagcact
    5751  ataatttcaa agtccagtga cgttattggt agagcgggta acgccgtcgc
    5801  atctgttaaa gcggctggga gtagtcttag caagcgtgtg aggcgcattc
    5851  gacctcctta ccctctcgta cggtgtgttg acgagcagac cagtgaatac
    5901  tactccgcta ctgatagctc tgaattggac gaagcattac ttagcgacgc
    5951  acccggtctt cgtgggaacg ggaggtgtgc ggatctgctt cgcgttgtta
    6001  ttaggcgagt tgtcatgtac cgcaggcgcg cggtagacgg tttaagttgt
    6051  ttagttttgc gcatcggtga tcactcttac tcatgcgtta tggacacgtt
    6101  tatgaggctg tttgtaaagc tgaacgttgt gattagcgag tgtaaacgac
    6151  ttaccgccga cagcgttgca aaagcttctg agctggcggt tggttgttta
    6201  tcgtggtgta accttcgttt cggcgcgaat tcttcagctc ccggtttgcc
    6251  tggcggtagc ggtggttcgg cttttagttt gttggaacac tgtcttaagt
    6301  gtgtcatcga cctgtttatt aatatgtggt cgtcagtgtt tgatgaaaac
    6351  ttttattcca gtttggtgca tcggttgaga atcacctcgg taaacgtgct
    6401  acttgagttc ctaaagaatc ttcctgtctg tttggtttgg atatacacct
    6451  ttatagaatg tcgttctagg gtttttcctt tgaaagagtt cctttggggt
    6501  ttctgcgttt tcgtccggaa catcattagg gaattgtcct tgaacatcta
    6551  cgggaacctg cccttctgcg tcacgagatt atgcgataga gtttttcgtc
    6601  gccgtcttaa tgaggacgat acgcgcactc ttcaagtgat tactgaggca
    6651  gaaaatcgtg tcgcctttct tcgggaggtc cttgccgaaa tgtcgcggta
    6701  ccgtgcttct cttgaggtgc cacttccagc ttcaccagac agtcctttat
    6751  ttccaccaac ttatggtgaa atcgaggagt tggggacagg ttcttccgac
    6801  aacgctcgcg taataggtgt ggatgacggt tcagactcgg cgaccacgga
    6851  aggtgaaacg aactcagttt cagacggtga cagtgatgtt tcgctaccgc
    6901  tagatcgtga tttcgagcaa atcggaggtc tggggggaaa cggtaacgtt
    6951  gacgtttgtc gtttagggct aaggtttcta tatagagtat cgcgtaacgc
    7001  gtttagtatg aaggctgtga ggtttttata tggattagtt cttcagagtg
    7051  tttttaaggg cggttcggtg agtgatttct tgtcgcgtgt gctgttcagt
    7101  ttgggcggtt gtttgccgtt tgaattcttt agaagcgtat gcgccgcgag
    7151  gtggttgtcg aagaggtggg cgttgcgagt tcgtaacgct aacgtttgcg
    7201  acgaggagac ggtcgaatat ttgtttagtt tttcacgact gttgtacgat
    7251  tcgcgttatt tgtctagcgt gttctcgtta ctggagaagg ttgatttcta
    7301  cttgagttac tcgttctcgc tgcccaaaag gtactttaca acgaaccgta
    7351  cggttcagct tcgtgttaga gctcccgtcc gcgtggttag cgccgcggaa
    7401  ccggttagag acagtgggaa gtctttagcc gaaatactaa actctttaga
    7451  ctcattaaag acacctacct gcaaagggaa gtcgacagtc gttgagagtg
    7501  acgattcgga ttccgatagt agccgctcaa ccggttctat cttgttcggg
    7551  tctgttaacg gggaagttat gagtgcggtg aatggtgatg gtgtttgtga
    7601  aaaggctccg ttgatgaagc atgcggccgc gctaagtgaa ttagaacctg
    7651  atgctagcgg tcgaaaaaat cttccgattg ttaggagaaa atttactcgt
    7701  ggcgagtctt cgggcacaaa gtcagccgga agcgtgtgcg tgtatttgac
    7751  tacattaaat tcgtcgtttg gttcggtgcc ggatttgtac cccgtcgcac
    7801  gtgacataga atataagaag ttgacgaatg ccatacgtga gttttactat
    7851  tcacaaaagg tgacactgta cgaacttcac ggaaaattga gctcgtattg
    7901  ggacgagttg aaggctgtgg gtttcgacag gaagttaacc aagatggatc
    7951  tggatgaaga cgttaatgtc gtcgattttt cctcgaaggt gttaatagga
    8001  aggaacggtt cccgcccttt tagaaacaca gtgaactctc acgagtttat
    8051  gttttgtgat gatgggttgg tgccgtgccc gggttcgaaa aaacgcgatt
    8101  ttgctttaat atctagtcaa acgtcattcg tcgccgcaaa ctcgtttctg
    8151  cgagctgtag acggtaaaga tttgacattc actaactcgg gccacagtct
    8201  catagtttac gaagctcctc ccggaggcgg gaagacccac tctttggtga
    8251  agtacttttc cgactactgt actaaagtat cctgtttggt ggttactgcc
    8301  aacaaaaatt cacaagcgga gatttctcaa cgaatctcca aagaactgat
    8351  ggataggaag atggttgcga aacacgtcat taaaactgct agtagggtgt
    8401  ttacagtgga ctcctatctg atgaatcata ttcatctcaa gactgaattg
    8451  ttatttgttg acgagtgctt tatggttcat gccggggcga tcggagccat
    8501  tgtagaattt acttcttgta aggcagtggt tttcttcggt gacagtaggc
    8551  aaattcatta tatccaccga aatgacttcg gtgtgtcgtt gttacacgat
    8601  atagacgcgt ttatacaacc ggagcaccgc gtttatggtg aagtgtcata
    8651  cagatgccct tgggatattt gtgagtggtt gtccaagttt tatccaagac
    8701  acgtagctac cgctaatatc gcaagcgttg gaaagtcaag cgtgtctata
    8751  gagataataa acggatacga cgacgttcct tatgaaagtg acgccaagta
    8801  tgtcgtttat acgcaggcag aaaagaatga attacagaaa catcttggcc
    8851  gtttgacagt gggccgtact aaaatagtac ccatcgttaa tacggttcat
    8901  gaagttcaag gggagacata caaaagggtt cgtttagtgc ggtgtaagta
    8951  ccaagaagac accccttttt gttcggacaa ccacgttgtt gtggcgttga
    9001  ctagacacgt tgactctcta gtttattcag tgttgaacag cagaagatac
    9051  gacaagactg cttccagcat agacgaggcg agagagattt ttgataaatt
    9101  tcgatcggcg aatcactccc acggttcgtc gtcattggag tggtacctcg
    9151  agaagtaccc taatgagtac aagggtagta aagcgtcttc ggctccgtta
    9201  agttgtatta acgagtttct taacgaagtc gtcgttggct cctcggtggt
    9251  gcaattagga gatacttctg aggaattaag ctctcaaccc tttgagtctg
    9301  gttgtgacaa cgtcactatt agggacactg cccctccaga ttctggtaac
    9351  ttacacgaac cggctcgtgt tcggcgtggt aaggtcacag gcaattccgc
    9401  caagaaaagc gtctctacaa gaaaatcttc tgtcatacga aagtcgtaat
    9451  tacaacttta ttaagaccga acggtacgtg gggcctgaga actttggtag
    9501  agcgatggca gcggctgtac tcgacagatg ttttaagatg gaagaagtgg
    9551  cgaagataag gagtgacata atcgctctga cagaagctaa tattgctaaa
    9601  tggctcgaca agcgcactcc atgtcaagtg aagtcagtgc aagcggagct
    9651  taagttaccg tttgccgcgg aagagcaaat tactaattat aagttaatgg
    9701  tgaaacgtga tgctaaggta aaacttgacg actcttgctt gtctaaacat
    9751  ccagccgcac agaacattat gttccataag aagtttatta acgctatata
    9801  ctccccgtgc tttgacgaat tcaagaacag ggtgctgtcg tcgttgaaca
    9851  gaaatatagt gttctttacg gagatgacga acgctgggtt ggcggaagtt
    9901  atcaggagga ttataggtga tgacgatgat ctgtttgtcg gggaggtaga
    9951  tttcagcaag tttgataaat cgcaagattt gttcatcaaa gagtacgaac
   10001  gctctttgta ttctgaattt ggtttcgacg acgaacttct tgacctgtgg
   10051  atggaaggtg aataccgcgc tagggctacc acgttggatg gccaattaag
   10101  tttttcggtt gacggtcaac gtcggtcggg aggttcgaat acgtggattg
   10151  ggaactcctt ggttaccttg ggtattcttt ctttgtacta cgatgtttcg
   10201  aggttcgaat tgcttctcat ctctggcgac gactctttga tctactctag
   10251  agcaccgatt agcaacttct cttcggaaat ttgtttggag acaggttttg
   10301  aaactaaatt tatgtctcct agtgtaccat acttttgttc aaagttcgtg
   10351  gttcaaactg gaaacaaaac gtgttttata ccggatcctt acaagctact
   10401  ggtcaagctg ggggctcctc agtacaaatt gaccgacgac gaactttttg
   10451  agctgttcac ttcttttaaa gatatcactc aagattttgg tgatcaggtg
   10501  gtcctagaga aactgaagtt cttagtggag gctaagtacg ggtttactag
   10551  cggaactact atgcccgctc tatgcgctat acattgcgtg cggtctaatt
   10601  atttgtcttt tgaaaggtta tttcccttta ttagaggttg gtatgttgtg
   10651  gacgctttga aacttagaca actgaggaag ttcgctgatt tgatctgtga
   10701  acgtgcggtt tacgacaatc gcgcgggtta tttttcgtac tttgacaatc
   10751  cgtttactaa acccgatgct agcgatggtc aagcggacga cttagcgaca
   10801  ggctgatagt ttgttcagtt ctcgctgaga gctaacacgg gtagttgagt
   10851  cgagatgttt gccttcgcga gtgaaaacca agatatatta gaagaaaaga
   10901  tttttcgccg tagaacctgc catcgtaagt attcgggtga cgtggttggg
   10951  gattttacca ttgatgttgg ttataatgct gccgatcgtg atcctacggt
   11001  actggctgat tatttctcgt tgtatttctt tttgcttaac aatgataaca
   11051  tcgggcctct agcagcttcg attgtagtga gcccgccagt aaacgggact
   11101  cataaaattc gggcgcacgt cgataatcaa ccgaatcgtg aaggaaacgt
   11151  tacttacgtt aagaccgtcg ataagagtcg ttttgtgatt cgcataaaag
   11201  cgatgcctgc tcctacgagg ggctactact cctttcggac gtttgttagt
   11251  ggtgacatcg ctagcgaacg tagcgagttt atgtgcagtt ttgttggtag
   11301  taggtatctt tgttgttgca cacaaacgat atccgaaaat ttgagtaccg
   11351  tttgttcgtc ttctttcttc tttagagccg tttcggaaac cgctactaat
   11401  gagttctctg ttgtgactga tgatgtagaa gacgttaagt acgtaagaaa
   11451  acgggtcgag ggtttttcac attgcgctga cccacatcct cctaggtgtt
   11501  atcgtaacaa taatttaggt gattcttcag gggttcaaag tcgcacgatt
   11551  gaagaggagg gttataggac ggacaccgta agtaacgtca cggtcaccat
   11601  cccgaatact ccgctcgtta atgccgtctc tccgtatgtc gcggagttca
   11651  acgaaaacac gcgttcgcgt gtctcgttaa tacggcgagt ctgctgttac
   11701  gccgtttgtg ttttagtagt ttctcttctc ataatgagcg gtttgatagc
   11751  catcatattt atatgacttg gtgtagtaac ttatggggca tggttagcta
   11801  aaactcaccg tttgactctg tttaaacggg gttcaatgga ctgtgtgatt
   11851  caaggatttt tgacttttct agttggtata gctgtgtttt cggcttttgc
   11901  cggactaatt atcattgtta taacgattta tcggtgtacg actaagcccg
   11951  ttagaaacgc ctctccttac ggcactcacg ccactatcta agcggtatgg
   12001  tgcttctggg tctagacttt ggtaccacgt tttcgacggt ggctatggct
   12051  acatcttctg agttagtgat acttaaacaa tccaattcgt cgtacatacc
   12101  tacgtgtttg tttctgcatg cagatcctaa cagcgtgtct tatggttacg
   12151  atgcggagta cttagcgact tcaggggaac ctggctcgtt ttacaaagat
   12201  ttgaaacggt gggtcggttg tactgagaag aactaccaaa gttatttgca
   12251  caagttatca ccttcctata aggtgatagt aaaagagttc ggaattaaga
   12301  gtatgccggt tccgtatttg tcacctctga ataatgatct tgggctcagt
   12351  gtcgctttgc cttcgttgat cgctttatat accaaatcga ttttatcgga
   12401  tgcggagagg gtgttcaacg tgagttgcac tggagttgta tgttcggtac
   12451  ctgctggtta taacacgttg caacgagctt ttacacaaca aagtgtgtcc
   12501  ttgtcgggtt atacttgcgt gtatatcatt aatgaacctt ccgctgccgc
   12551  ttactccact ttacctaagt tgagttcggc ggataaatac ttggccgttt
   12601  acgacttcgg cggtgggacc tttgacgttt ctatagttag tgttaggtta
   12651  cccacgttcg ccgttagaag ttcgggtggt gatatgaact taggcggtag
   12701  agacatcgat agaaagttat ctgataaaat atatgagttg gctgattttt
   12751  taccgcaaaa agaactgaac gtttcgagtt taaaggaagc tttatctctt
   12801  caaacagatc cagtcaagta tactgtaact cattacggga tgagtgaaac
   12851  cgtatcaatc gatcaaacaa cgttgaggga gatagcttcg gtatttataa
   12901  ctcgaacggt agacatactt acacaagtta aagctaagtc tagtatgccc
   12951  gagtcgcaaa gtttgaagct agtggtagtc ggtggaagct cgtacttacc
   13001  agggttgttg gatactttgg aaactgtacc ttttgtgtct gggatagtac
   13051  cggtggaaga cgcaagaacc gccgttgcta gggggtgcgc tttatatagc
   13101  gagtgtctgg atggtaggtc caaggcctta ctaatagatt gcattacgca
   13151  tcatttgtcg gttacgacat ttagtgcaga ctcggttgtt gttgctgcgg
   13201  ccggaagtcc aattcctttt gaaggagaac gaagactcac gttgcgtaag
   13251  tgtgttagta catcgaatta tcaagcaagg atgttcgaag gagattacga
   13301  aaaagttttc cgaaacgaac gtatatacgc agcttcagtg tcattgttta
   13351  ctttaggagt taactggcgc gtgcctaacg acgttgagat gactctcgtg
   13401  accaaagtgg actcaatggg taaagtggaa ttctacctta aaggtccatc
   13451  tggtgaatta gttaacgtgc aaggtacttc acattatgat tatgttggta
   13501  tgcctcatcc cactagaaag ttgttgaggc ttagcgatta caatgtaaac
   13551  tccgccgctt tagttttagc tttgacattg actcgcgaaa aacgagaaaa
   13601  atttcttttg cgaacattat tcgatacttt actagcggac ctgcgaaaga
   13651  ccgcaagttt aagcgaatat tctaagaaat atccgattac tcgaaacgat
   13701  atcgatgtcg tctcatcacg tatggggatc gttgtttcga aagttttacg
   13751  gggaagcgat ttggaaagag tacctctctg aatcaactcg aaatttcgat
   13801  gagagaaaca tatcgttgga ccacacttta agctcaggtg tggtcgtccg
   13851  taggcaaaat cttttgaacg cacctcaagg aacttttgag aatgagttag
   13901  cgctattata caattcagta gtaattaacg attttgttga gttgactggt
   13951  atgccgttga agtctttgat gacgggtgtt gaagaccgta aaatacctga
   14001  cgagttaata tccgttgacc cgcatgaagt tggatgtaga ttcacgttga
   14051  atgatgtaga atcatatcta ataagcaggg gtgaggattc cgctgatgta
   14101  acggcggttg agcactcgtg gtgtttgagc aattcttgtg gtaaattgtt
   14151  aagttcgact gaaatagata cttacaaaac tatggtgttt actaagactt
   14201  ttgatagtgg tgtacttggg gtgaccacta aattagagat gtatctatca
   14251  tactgcatat cgttgtacaa gaaacattgt atgaaagacg atgattactt
   14301  taaccttata ttacctatgt ttaattgttt gatgaaggtg ctggcgtcgc
   14351  ttggtttgtt ttacgaaaaa tatactgaca atccgctgct gaccggcatg
   14401  cttatagagt tttgcctaga aaataaggtg tattactcta cttttaaagt
   14451  aaatttggac aacgttaggc tgtttaagtc taaagtgttg cctgtggtgt
   14501  taacggtctg ggatatatct gagcctgatg acccggtgga cgagaggaca
   14551  ctagttcctt tcgatcctac ggatttcgtg cttgatatac ccaaactgaa
   14601  tatacacgac acgatggtgg tggtaggtaa tcaaatcaga cacttagagc
   14651  acgtggttga gagcgatgct ttagacgact tgtctcaaca cgttgacttg
   14701  aatttagcag cggacaatcc cgatctacgt gttgatttgc gttgggcagg
   14751  gatgtttgtg tattacggcg tataccggtg tgctgtggat agagtggtgg
   14801  aacgaccggc gttatttaat ttaccgcgga agttgttaaa tcaggacgac
   14851  ggtgagtcat gcttgttacg tatgagttcc gttgaaacct tatttaatct
   14901  ggtgcagaag gtaaataagg acataaacat caggcgtcaa ttcatgggac
   14951  gtcatagtaa agtggctttg cgggtgtatc gcaatttagg tttgaagttt
   15001  cctccaattt cctcagttag gttaccagct catcacggct acttgtacgt
   15051  cgacttttac aaaagaatac ctgataatgc tgttgatgcc gacgaactgg
   15101  aaagtttacg tcaattacgt tcatccgtgg acgttatgtg taaggacaga
   15151  gtgtcagtca cgcctccacc gtttaatcga catagaagag gttcttctag
   15201  aatacttgga ggtggaggcg cacgcggtgc gagctcgcgt tatatgagca
   15251  gagagggggc aacatccggt tttaatttac cctttcatca tggcgggtta
   15301  cacgatgctt cccaaaactg atgacaaaga aatggacccg gtgagtgccg
   15351  ctgtgcccgg taaatacccg gacgttatcg aaaagtttgt gaccaatagg
   15401  tcggtagatg cgttaataga aggtgttatt agcaagttgg atactaattc
   15451  aatatacgaa gattccactg aaaaatttac tggtgagcaa ttgaagtacg
   15501  tcatggttac tatggacact ttcttactag aaaattacaa aacgaaaacg
   15551  gaagatctgc tggttcactt ggctatgatt caaaagaggt tgtgcactat
   15601  atctacgagt actaaaacca aatttcgtga taaaggttgt atcagttacg
   15651  tgcaaggggg tttacgatat aagttaatgg ataaagtagt ttttcctttt
   15701  attatatcta agtttactga cagggagact ccaaatgctc tacgtaagta
   15751  tgcttgtact tttgaggagt tgcacttgtg cacggctaga ctgagacccg
   15801  acttatacga aaacaaaagg acgaccaaag ctgggactcc gcatttaaaa
   15851  gggtacttat cagctgactt tcttacgggt tccctcccag gatactccga
   15901  acatgaacga ggtatcatcc ttcgagcgtc tgagtctatg ttagctagac
   15951  gtcaaggtta cgaggaggca accgaacttc ttaacttacg cgatttggga
   16001  aagtatttgt agttagtttg cggacggcgg tattacgcca tcccatgagc
   16051  actgctttaa gggtcgttaa ttgacgactc ttgatattta ctaagtttga
   16101  gttatggacg acgagacaaa gaaattgaag aacaaaaaca aggaaacgaa
   16151  ggaaggcgac gatgttgttg cagcggagtc ttctttcggt tccttaaact
   16201  tacacatcga tccgactctg atagcgatga acgatgtgcg tcagttaggt
   16251  acccaacaga acgccgcttt gaacagagat ttgttcctta ctttgaaagg
   16301  gaaatatcct aatttgtctg ataaagataa ggactttcac atagctatga
   16351  tgttgtatcg tttggcggtt aagagttcat cattgcaaag tgatgacgac
   16401  accacgggca taacgtacac tcgagagggc gtcgaagtgg atttgtctga
   16451  caaactttgg actgacgtcg tgtttaattc taagggtatc ggtaaccgta
   16501  ctaacgccct tcgagtctgg ggtagaagta acgatgccct ttatttagcg
   16551  ttttgtagac agaatcgcaa tttgagttat ggcggacgtc cgctagacgc
   16601  agggattccg gccgggtatc attacctgtg tgcggatttc ttgaccggag
   16651  ctggcttgac tgatttggaa tgtgctgtgt acatacaagc taaagaacaa
   16701  ttgttgaaga agcgaggggc tgatgaagtt gtagttacca atgtcaggca
   16751  gcttgggaaa tttaacacac gttgatctat tgcgttctga ttctcgattt
   16801  ctatcgggat ggtggagttt catcgtgaac gtgggtgata taatcgttcg
   16851  gtttgcgtta catgttccta gtgaggatat gctgaatagc ttttcagcta
   16901  tatcgaattg tgcgatcata gcagacggta gtgctttact aaaagacaac
   16951  actgtggttg accgtttaga gagcatgaat cctttggctt atttgttaaa
   17001  attagcgaaa acgactacta ctatttgttt tactatgtct aataaggttc
   17051  tttttggtac tactaaatct gaaccgctta gttgtttagc tatcacgtcg
   17101  gatcgagttt tattcaaagt tattatgggt attaacgttg atgattctcg
   17151  atgtggctgc agtatttggt tttacaacaa tgggacgttt caaaacgggt
   17201  tgacccgttg taacaatctc gtcgctttgt ttagcgcgac ttagacacga
   17251  agtgaccgtt cgggtttaat tgctgcaatg ggtattcgac gcgtgtggtt
   17301  aaaggttatg gctgtaatta cggtattgtg gtatggtaag gaaccttcca
   17351  ttagcgaagg ttacaatgct cttatgaatg atgactttaa gttcatcgat
   17401  gcgcactttt caaatgtttc ttatgctaag aaatgttacg agttggctaa
   17451  cttcgactta gactttctac gcatcgttat cattcctttg agtggtggta
   17501  cggtgaatga atcgcgtgct gatcgcacta acgtttcaga aattgtcgaa
   17551  tcgcatgtga gcgaccgaga caggatgagc atcttgttgc gtaataagcg
   17601  gatccaaatt ccttcgctct taccttgcga tagctagagt ctactcagta
   17651  gtacgtctac tagtataacg tattaaacac tttagtgagg agttttgttt
   17701  aaactaaaca atatgcgagc ttactttagt gttaacgatt acataagcct
   17751  tttggctaag gtcggcgcag ttgtggaacg tttgtgcgat cctagcgtaa
   17801  ctctcacgga agtgatggac gaaattaatg attttaactc gtttctcgct
   17851  ttggtacact ctatgaagtc ggacatgaac ggcgatcatc aggatggtca
   17901  ccatgagatg ggtgaacaca agtctcgatt gttgtgcaat atagaggcga
   17951  aactgcgaat acttctcgac atcataagac gtcggtttac tcgcgacaag
   18001  ctgctctgta ccagcgcaac agatgtcatg ggcttcttcg ttatgaggta
   18051  catgagttct agtcacacca gtttcgagtc cgtaatgcga acggagctga
   18101  aattagtggt taaagcggta ctgtcggatt tatcccgcgc gcataaacta
   18151  gatttcagcg agcgagcctt tgcggcttac ggtatccttt tacaaaaggg
   18201  tactgtatcg accgtttgcg gtcagtttga cattaattta gtttctcctt
   18251  catgcgtgta ggttaatacg cttctcagaa cgtgtggttg tattaactaa
   18301  ctttaattcg aacaagttta ttgttaaaag tctgtgagtt acgatgaacg
   18351  atactagcgg acaaactttt atttctgtga acctttctga cgaaagcaac
   18401  acagctagta ctgaaatcaa agccgtaagt tcggaagcgg atcgcttgga
   18451  atttttacgg aaaatgaatc ccttcattat cgacgctttg atacggaaaa
   18501  acagttatca aggcgctcgc tttcgcgcga gaataatagg agtgtgcgtg
   18551  gattgtggta gaaaacacga taaggcatcg aggactgaac gtaagtgtaa
   18601  ggtcaacaat acgcagtctc agaacgaggt ggcgcatatg ttgatgcacg
   18651  atcccgtaaa atatttaaat aaaagaaaag ctagagcctt ttctaacgca
   18701  gagatgtttg cgatcgattt ggttatgcac accaaagaaa ggcaattagc
   18751  ggttgatttg gccgctgaaa gggagaagac gagattggct cgtagacacc
   18801  cgatgcgttc tccggaagag actccggaac attataaatt cggtatgact
   18851  gctaaggcaa tgttaccgaa catcaacgct gtagacgttg gtgataacga
   18901  agacacctcg tcggagtacc cagtaagtct gagcgtttcc ggcggagttc
   18951  tccgtgaaca ccacttcatc tgattgaagt ggacggaata agttcctcgc
   19001  ggaactatat gtcgggttgg taaaaaccct tatgatggtg atatatcact
   19051  agacaataac cggatgggta aagtctttaa aatgatcgag gggaaaatta
   19101  accatatcct ctcgttggtc taagctccca cagagtggta gtggtctcaa
   19151  gtgaggctta acgtatgcgt gaaccaaaga agttctcctt agagtgtgtg
   19201  ttgtttaccc aacacactgt ccctatgggg ggccaacata ggtcca