Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 6B coat protein (CP) gene, complete cds.

ACC No: JX090143

Dated: 2012-07-31 | Length: 672 | CRC: -237421716

                
ID   JX090143; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   JX090143;
XX
DT   31-JUL-2012 (Rel. 113, Created)
DT   31-JUL-2012 (Rel. 113, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 6B coat protein (CP) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Saponari M., Fontana A., Ferretti L., Albanese G.;
RT   "Characterization of Citrus tristeza virus population spreading in calabria
RT   (southern italy): evidences on the presence of severe seedling yellows
RT   strain";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Saponari M., Fontana A., Ferretti L., Albanese G.;
RT   ;
RL   Submitted (20-MAY-2012) to the INSDC.
RL   Institute of Plant Virology, CNR, via Amendola, 165/a, Bari, Italy 70126,
RL   Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Satsuma mandarin"
FT                   /isolate="6B"
FT                   /serotype="MCA13 reactive"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy:Calabria"
FT                   /collection_date="2010"
FT                   /note="genotype: VT-like"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="CP"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="AFO65004.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPSLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 190 A; 120 C; 178 G; 184 T; 0 other;

jx090143 Length: 672  31-JUL-2012  Type: N  Check: 5639  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg agacgaaaga
      51  aggcgacgat gttgttgcag cagagtcttc tttcggttcc gtgaatttac
     101  acatcgatcc gactctgata acgatgaacg atgtgcgtca gttgggaacc
     151  caacagaacg ctgctttgaa cagagatttg tttcttactc tgaaagggaa
     201  gtatcctagc ttgtctgaca aggataagga cttccacata gctatgatgt
     251  tatatcgttt agcggttaag agttcatcgt tgcaaagtga tgatgacacc
     301  acgggcataa catatactcg ggagggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  atgcccttcg agtctggggt aggactaacg atgcccttta tttagctttc
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggct gggtatcatt acctatgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa ggaacaattg
     601  ttaaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga