Sequence of DPV Moroccan pepper virus

Moroccan pepper virus isolate MPV-EM81, complete genome.

ACC No: JX182425

Dated: 2013-01-01 | Length: 4772 | CRC: 493324502

                
ID   JX182425; SV 1; linear; genomic RNA; STD; VRL; 4772 BP.
XX
AC   JX182425;
XX
DT   01-JAN-2013 (Rel. 115, Created)
DT   01-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Moroccan pepper virus isolate MPV-EM81, complete genome.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4772
RA   Wintermantel W.M., Hladky L.L.;
RT   "Complete genome sequence of Moroccan pepper virus";
RL   Unpublished.
XX
RN   [2]
RP   1-4772
RA   Wintermantel W.M., Hladky L.L.;
RT   ;
RL   Submitted (14-JUN-2012) to the INSDC.
RL   Virology, USDA-ARS, 1636 East Alisal Street, Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4772
FT                   /organism="Moroccan pepper virus"
FT                   /isolate="MPV-EM81"
FT                   /mol_type="genomic RNA"
FT                   /country="Morocco:Rabat-Sale"
FT                   /isolation_source="eggplant"
FT                   /note="collected in either 1980 or 1981; virus stored in
FT                   laboratory freezer and reactivated for sequencing"
FT                   /db_xref="taxon:208086"
FT   CDS             join(167. .1054,1058. .2623)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="92 kDa protein"
FT                   /note="replication protein; P92"
FT                   /protein_id="AFM91108.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFSIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVTASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVKGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRAGPPNAKDRNIFM
FT                   VAGCPSQARFLVHNHCLKNLKRGLVERVFCVEKNGILTRTPQPTKGAFSRLSPFRKAVC
FT                   EKVGVAHRLGYDGFLSYYNGAKLRTYKRAVESLHITPVSERDSHLTTFVKAEKISTAKG
FT                   DPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREKW
FT                   DRFDKPVAIGLDASRFDQHGSVEALQFEHSFYRALYPGNKLLSKLLDWQLHNKGKGYVP
FT                   DGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEFSLANCGDDCVLIVERR
FT                   NLKQIQGTLPEYFLGLGYTMKVEKPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSKD
FT                   VHCVNNIRDLATRRAWSNAQHFGGRALTSGIPVVDKFYSRFVVYDAPKKHQRIDTVTNV
FT                   HKWRGSGGAYTVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSIL
FT                   DSAVA"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /note="replication protein; P33"
FT                   /protein_id="AFM91105.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFSIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVTASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
FT   CDS             2645. .3820
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AFM91109.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLRKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKTQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYTFNNI
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGLTTGPSYLTVSSTATVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
FT   CDS             3854. .4423
FT                   /codon_start=1
FT                   /product="22 kDa protein"
FT                   /note="P22"
FT                   /protein_id="AFM91107.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVALLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGQEI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3886. .4404
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /note="P19"
FT                   /protein_id="AFM91106.1"
FT                   /translation="MERAIQGNDAREQANSERWNGGSGGSTSPFKLSDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTEASLHRVLGSWTGDSVNYAASRFFG
FT                   INQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAVRAKQELLQLTPVEVESNVSRRCPEG
FT                   FKAFEEESE"
FT   CDS             4487. .4663
FT                   /codon_start=1
FT                   /product="putative 4 kDa protein"
FT                   /note="ORF6"
FT                   /protein_id="AFM91110.1"
FT                   /translation="MMTSQVGLYGGFGRPWDGDMERVSYAVRLTSVELAIWTYAWISHN
FT                   VTAQCKLDANLQL"
XX
SQ   Sequence 4772 BP; 1247 A; 998 C; 1295 G; 1232 T; 0 other;

jx182425 Length: 4772  01-JAN-2013  Type: N  Check: 3957  ..

       1  agaaattccc caggatttct cgacctagtt cgtttatctg gtgacttgcg
      51  cttctgttgc tttgcgtagg gaatttctct ccttaattac tatctttaat
     101  tttggggttt gaaggttggg tctacctttc ggggggataa attgtaactt
     151  ccaacaaata agcacaatgg agaccatcaa gagaatgatt tggcctaaga
     201  aggagatctt tgtaggagat tttgcgatcg gagttaatag gacggcaccg
     251  gtggacatct tccagttggt gtgtcgtgtg gttctaagat acatgaggac
     301  agggaaaata gagtgtgatt ctgacagcat gacaaagttt gtggttgagt
     351  tacttaagac agactgtgct gccaaatggg agtggtttat gaagagacgg
     401  cagaggggtg actatatcgt ccctctatct atagcctcca tcccaatcat
     451  accgctgttg agttacgcca cgagggtacg cgctgtctca gtcaaggctt
     501  ttggtaatga acttacgttc agtattcgag tgcctagacc atctgtacct
     551  aagaaaggtt tactcctcag actggcggca ggactagcac tcgcacctat
     601  atgcgcgcta gccatgtacg ctaccctacc tagggaaaaa ctgtcggtat
     651  tcaagcttag aactgaggca cgggctcaca tggaggatga gagagaagcg
     701  acagattgtt tggtggttga accggctcgt gaacttaagg ggaaggatgg
     751  agaagatctc ctcactggta gtagaatgac aaaggtaact gcgtccacgg
     801  gacgccctcg ccgcagaccg tacgctgcga agattgcgca agtggcgaga
     851  gcaaaggtgg gttaccttaa aaacacgcct gagaacaggt tgatctatca
     901  gagagttatg attgagatca tggacaaaga ctgcgtccgg tatgttgaca
     951  gggatgtcat attacctctg gctataggat gttgctttgt gtatccggat
    1001  ggagtagagg agtcggcggc actatggggt tcttcggaat cccttggtgt
    1051  gaaataggga ggcctagtac gtctacctgg ggttgtaaca cagaccaata
    1101  gagatatccc atctggtgtg ttgcttcccc aggaggtgct agaggttcgt
    1151  gcaggacctc ctaatgctaa ggaccgtaat atatttatgg ttgctggttg
    1201  cccatcacag gcacggttct tagtacataa tcactgcctg aaaaacctaa
    1251  aaaggggtct tgtggagaga gttttctgtg tcgagaagaa cggaattctc
    1301  actcgcactc cacaacctac caaaggagcc tttagtcgtc tttccccgtt
    1351  caggaaagca gtctgtgaga aggttggagt agcccaccga cttgggtatg
    1401  acgggtttct gtcatactac aacggtgcga aactccgtac ttacaaacgg
    1451  gctgtggaga gtctgcatat cacacctgtc tcggagaggg atagtcatct
    1501  gactaccttc gtcaaggcgg agaagatatc gacagctaaa ggtgacccag
    1551  cacctagggt gatacagcct cgtaatccta ggtataatgt cgagcttgga
    1601  agatatctac ggcatatgga atccaaactg atgaaagctg tggatggcgt
    1651  atttggagaa acgacatgca tcaagggata tactgccgat gaggttggcg
    1701  ctatttttcg ggagaagtgg gacaggtttg acaagcctgt agccataggt
    1751  ctcgacgcgt caaggtttga tcaacacggt tccgtggagg ctttgcaatt
    1801  cgagcatagt ttctacaggg ccctgtaccc tggtaacaag cttttgagca
    1851  agttattgga ctggcaactc cataataaag gtaagggtta tgttcctgat
    1901  gggactatta cctatcgcaa ggagggctgc cgcatgagtg gggatataaa
    1951  cacctcgttg ggcaattatc tactaatgtg tgctatgatc tatggataca
    2001  tgcgccattt ggggatcaat gagtttagtc tggcgaactg tggggatgat
    2051  tgtgttctaa ttgtagagcg caggaatctt aaacagatac agggcacact
    2101  acctgagtat ttcctaggac taggatacac aatgaaggtg gaaaaacccg
    2151  tgtttcaatt ggaagaggtt gaattttgcc aggcacaccc cgtgcagttt
    2201  caaggtggtt ggaagatggt cagaaatgtc cgcactgcaa tgagtaaaga
    2251  tgtgcactgt gtcaataaca tacgggatct cgctacgcgt agagcctgga
    2301  gtaacgcaca gcatttcgga ggaagggcgt tgacgtccgg tatcccggtt
    2351  gttgacaagt tctactctcg gtttgttgta tatgatgccc ccaagaagca
    2401  tcaacgtatt gacacagtaa ccaatgtgca taagtggcgg ggatccggtg
    2451  gggcgtatac tgtgactcct gaatctaggg ctagtttctg ggctgccttt
    2501  ggactcacgg gggatgaaca gttagcgctt gaggaccgtt tggacagatg
    2551  ggagatggat ctatttggag aggagggtgt tgacgctcat gagcccagca
    2601  tccttgactc cgccgtagca tgaccaagca agataagtta cacaatggca
    2651  atggtagtaa gaaacaacaa cacagcatta gtaccgtata gtggaggcaa
    2701  gcgtggcctc cggaaagcat ttggatttgg agctacaatc gtcgggcaaa
    2751  agatttatga taatcgcggt aagattgtag ggttcatggt agaacaagga
    2801  aagaaaggtc taagtaagat ggctaatgct ctcggttatg gcaatggtca
    2851  gaaaactcag aatctggttg gtgggatggg tggggccatt atggctcctg
    2901  ttgcggtctc gaggcagctt cgtgggagta aaccccggtt tactggacgc
    2951  acagctggtt ctgttactgt cacccaccgt gagtatgtac gacaggtaaa
    3001  caacacgtct gccttcacag tcaatggggg tattgtcggg aatttgtatc
    3051  aactgaatcc tttgaacggt actctgttca cttggttgcc ctccatagca
    3101  tccaattttg atcaatacac gttcaataac atcacgttgc actatgtccc
    3151  cctctgtagt actactgagg taggtcgtgt tggattatat catgacaaag
    3201  actcacagga tcctgagcct actgataggc aggagttggc gaactttagt
    3251  acccttaaag agacaccccc ctggggtgaa gtaatgttgc gaatacccac
    3301  tgataggatc aagaggtact gcgatgacag taacgcagtc gatcataagc
    3351  taattgattt gggtcaagta ggcattgcta catatggggg tgctggcgcc
    3401  aacgccgtgg gtgatgtgtt tatatcgtat agcattactt tattctcacc
    3451  tcagcccact agctcattgc ttagcacaag acaacagagc cttctcggtg
    3501  ccaccggtct cacgactggc ccgagttact tgacggtgtc cagcacggcg
    3551  accgttctca ccttgacgtt tagagctact ggcaccttta tggtctccgg
    3601  tcacttccgt gatactgggg cagccgtatt aggtctcgct ggtaatatca
    3651  atgtaaattc actgacagtc ttggatacgg ttggtttggc cacctcgttt
    3701  tccattaatt gttcagtgtc cgctttaccg tctaccatta cctttacctc
    3751  cacagcaata acatcttcca cggtacactg tgtacgggcc gtaagggcca
    3801  atgatgccac attgttgtaa ctatgtgagg ggcttcttga acaagaccag
    3851  ttcatggata ctgaatacga acaagtcaat aaaccatgga acgagctata
    3901  caaggaaacg acgctaggga acaagctaac agtgaacgtt ggaatggagg
    3951  atcaggaggt agcacttctc ccttcaaact ttctgacgaa agtccgagtt
    4001  ggactgagtg gaggctacat aacgatgaga cgaattcgaa tcaagataat
    4051  ccccttggtt tcaaggaaag ctggggtttc gggaaagttg tatttaagag
    4101  atatctcaga tacgacggga cggaagcttc attgcacaga gtccttggat
    4151  cttggacagg agattcggtt aactatgcag catctcgatt tttcggtatc
    4201  aaccagatcg gatgtaccta tagtattcgg tttcgaggag ttagtgtcac
    4251  catttctgga gggtcgagaa ctcttcagca tctctgtgag atggcagttc
    4301  gggctaagca agaattgcta cagcttaccc cagtcgaagt ggaaagtaat
    4351  gtatcaagaa gatgccctga aggctttaaa gccttcgaag aagaaagcga
    4401  gtaagacaga ctcttcagtc tgagtgagtg gaagcaagca ctaacctaga
    4451  tagcatgtgg gttacttgca ctggcatgca gccgttatga tgacgagtca
    4501  ggtcgggctc tacggtgggt ttggtcgccc atgggacgga gatatggaaa
    4551  gggtctcgta cgctgttaga ctaacttcgg ttgagcttgc gatatggacc
    4601  tatgcctgga taagtcataa tgttactgcc cagtgtaaat tggatgccaa
    4651  cttacaactt taggagtact tgtggaacct cacgatgaca cggttgatct
    4701  cacccttcgg gggggctata gagatcgctg gaagcactac cggacaaccg
    4751  gaacattgca gaaatgcagc cc