Sequence of DPV Moroccan pepper virus

Moroccan pepper virus isolate MPV-PM75, complete genome.

ACC No: JX197071

Dated: 2013-01-01 | Length: 4772 | CRC: 132108075

                
ID   JX197071; SV 1; linear; genomic RNA; STD; VRL; 4772 BP.
XX
AC   JX197071;
XX
DT   01-JAN-2013 (Rel. 115, Created)
DT   01-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Moroccan pepper virus isolate MPV-PM75, complete genome.
XX
KW   .
XX
OS   Moroccan pepper virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4772
RA   Wintermantel W.M., Hladky L.L.;
RT   "Complete genome sequence of Moroccan pepper virus";
RL   Unpublished.
XX
RN   [2]
RP   1-4772
RA   Wintermantel W.M., Hladky L.L.;
RT   ;
RL   Submitted (19-JUN-2012) to the INSDC.
RL   Virology, USDA-ARS, 1636 East Alisal Street, Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4772
FT                   /organism="Moroccan pepper virus"
FT                   /host="pepper"
FT                   /isolate="MPV-PM75"
FT                   /mol_type="genomic RNA"
FT                   /country="Morocco"
FT                   /collection_date="1975"
FT                   /note="type isolate; virus stored in laboratory freezer and
FT                   reactivated for sequencing"
FT                   /db_xref="taxon:208086"
FT   CDS             join(167. .1054,1058. .2623)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="92 kDa Protein"
FT                   /note="replication protein; P92"
FT                   /protein_id="AFM91594.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVKGGLVRLPGVVTQTNRDIPSGVLLPQEVLEVRAGPPNAKDRNIFM
FT                   VAGCPSQARFLVHNHCLKNLKRGLVERVFCVEKNGILTRTPQPTKGAFSRLSPFRKAVC
FT                   EKVGVAHRLGYDGFLSYYSGAKLRTYKRAVESLHITPVSERDSHLTTFVKAEKISTAKG
FT                   DPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREKW
FT                   DRFDKPVAIGLDASRFDQHCSVEALQFEHSFYRALYPGNKLLSKLLDWQLHNKGKGYVP
FT                   DGTITYRKEGCRMSGDINTSLGNYLLMCAMIYGYMRHLGINEFSLANCGDDCVLIVERR
FT                   NLKQIQGTLPEYFLGLGYTMKVEKPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSKD
FT                   VHCVNNIRDLATRRAWSNAQHFGGRALTSGIPVVDKFYSRFVVYDAPKKHQRIDTVTNV
FT                   HKWRGSGGAYTVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSIL
FT                   DSAVA"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /note="replication protein; P33"
FT                   /protein_id="AFM91595.1"
FT                   /translation="METIKRMIWPKKEIFVGDFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYIVPLSIASIPIIPLLSYATRV
FT                   RAVSVKAFGNELTFNIRVPRPSVPKKGLLLRLAAGLALAPICALAMYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRMTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNTPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSSESLGVK"
FT   CDS             2645. .3820
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AFM91596.1"
FT                   /translation="MAMVVRNNNTALVPYSGGKRGLQKAFGFGATIVGQKIYDNRGKIV
FT                   GFMVEQGKKGLSKMANALGYGNGQKAQNLVGGMGGAIMAPVAVSRQLRGSKPRFTGRTA
FT                   GSVTVTHREYVRQVNNTSAFTVNGGIVGNLYQLNPLNGTLFTWLPSIASNFDQYAFNNV
FT                   TLHYVPLCSTTEVGRVGLYHDKDSQDPEPTDRQELANFSTLKETPPWGEVMLRIPTDRI
FT                   KRYCDDSNAVDHKLIDLGQVGIATYGGAGANAVGDVFISYSITLFSPQPTSSLLSTRQQ
FT                   SLLGATGLTTGPSYLTVSSTTTVLTLTFRATGTFMVSGHFRDTGAAVLGLAGNINVNSL
FT                   TVLDTVGLATSFSINCSVSALPSTITFTSTAITSSTVHCVRAVRANDATLL"
FT   CDS             3854. .4423
FT                   /codon_start=1
FT                   /product="22 kDa protein"
FT                   /note="P22"
FT                   /protein_id="AFM91597.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLTVNVGMEDQEVALLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   RVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3886. .4404
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /note="P19"
FT                   /protein_id="AFM91598.1"
FT                   /translation="MERAIQGNDAREQANSERWNGGSGGSTSPFKLSDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDGTEASLHRVLGSWTGDSVNYAASRFFG
FT                   INQIGCTYSIRFRGVSVTISGGSRTLQHLCKMAVRAKQELLQLAPVEVESNVSRRCPEG
FT                   FKAFEEESE"
FT   CDS             4487. .4663
FT                   /codon_start=1
FT                   /product="putative 3.7 kDa protein"
FT                   /note="ORF6"
FT                   /protein_id="AFM91599.1"
FT                   /translation="MMTSQVGLYGGFGRPWDGDKERASYAVRLTSVELAIWTYAWISHN
FT                   VTAQCKLDANLQL"
XX
SQ   Sequence 4772 BP; 1246 A; 994 C; 1299 G; 1233 T; 0 other;

jx197071 Length: 4772  01-JAN-2013  Type: N  Check: 3909  ..

       1  agaaattctc caggatttct cgacctagtt cgtttatctg gtgacttgcg
      51  cttctgttgc tttgcgtaga gaatttctct ccttaattac tatctttaat
     101  tttggggttt gaaggttggg tctacctttc ggggggataa attgtaactt
     151  ccaacaaata agcacaatgg agaccatcaa gagaatgatt tggcctaaga
     201  aggagatctt tgtaggagat tttgcgactg gagttaatag gacggcaccg
     251  gtggacatct tccagttggt gtgtcgtgtg gttttgagat acatgaggac
     301  agggaaaata gagtgtgatt ctgacagcat gacaaagttt gtggttgagt
     351  tacttaagac agactgtgct gccaaatggg agtggtttat gaagagacgg
     401  cagaggggtg actatatcgt ccctctatct atagcctcca tcccaatcat
     451  accgctgttg agttacgcca cgagggtacg cgcagtctca gtcaaggctt
     501  ttggtaatga actcacgttc aatattcgag tgcctagacc atctgtacct
     551  aagaaaggtt tactcctcag actggcggca ggactagcac tcgcacctat
     601  atgcgcgcta gccatgtacg ctaccctacc tagggaaaaa ctgtcggtat
     651  ttaagcttag aactgaggca cgggctcaca tggaggatga gagagaagcg
     701  acagattgtt tggtggttga accggctcgt gaacttaaag ggaaggatgg
     751  agaggatctc ctcactggta gtagaatgac aaaggtaatt gcgtccacgg
     801  gacgccctcg ccgcagaccg tacgctgcga agattgcgca agtggcgaga
     851  gcaaaggtgg gttaccttaa gaacacacct gagaacaggt tgatctatca
     901  gagagttatg atcgagatca tggacaaaga ctgcgtccgg tacgttgaca
     951  gggatgtcat attacctttg gctataggat gttgctttgt gtatccggat
    1001  ggagtagagg agtcggcggc actgtggggt tcttcggaat cccttggtgt
    1051  gaaataggga ggcctagtac gtctacctgg ggttgtaaca cagaccaata
    1101  gagatatccc atctggtgtg ttgcttcccc aggaggtgct agaggttcgt
    1151  gcaggacctc ctaatgctaa ggaccgtaat atatttatgg ttgctggttg
    1201  cccatcacag gcgcggttct tagtacataa tcactgcctg aaaaacctaa
    1251  aaaggggtct tgtggagaga gttttctgtg tcgagaagaa cggaattctc
    1301  actcgcactc cacaacctac caaaggagcc tttagtcgtc tttccccgtt
    1351  caggaaagca gtctgtgaga aggttggagt agcccaccga cttgggtatg
    1401  acgggtttct gtcatactac agcggtgcga aacttcgtac ttacaaacgg
    1451  gctgtggaga gtctgcatat cacacctgtc tcggagaggg atagtcatct
    1501  gactaccttc gtcaaggcgg agaagatatc gacagctaaa ggtgacccag
    1551  cacctagggt gatacagcct cgtaacccta ggtacaatgt cgagcttgga
    1601  agatatctac ggcatatgga atccaaactg atgaaagctg tggatggcgt
    1651  atttggagaa acgacatgca tcaagggata tactgccgat gaggttggcg
    1701  cgatttttcg ggagaagtgg gacaggtttg ataagcctgt agccataggt
    1751  cttgatgcgt caaggtttga tcaacactgt tccgtggaag ctttgcaatt
    1801  cgagcatagt ttctacaggg ccctgtaccc tggtaacaag cttttgagca
    1851  agttattgga ctggcaactc cataataaag gtaagggtta tgttcctgat
    1901  gggactatta cctatcgcaa ggagggctgc cgcatgagtg gggatataaa
    1951  cacctcgttg ggcaattatc tactaatgtg tgctatgatc tatggataca
    2001  tgcgccattt ggggatcaat gagtttagtc tggcgaactg tggggatgat
    2051  tgtgttctaa ttgtggagcg caggaatctt aaacagatac agggcacact
    2101  acctgagtat ttcctaggat taggatacac aatgaaggtg gaaaaacccg
    2151  tgtttcaatt ggaagaggtt gaattttgcc aggcacaccc cgtgcagttt
    2201  caaggtggtt ggaagatggt caggaatgtc cgtactgcaa tgagcaaaga
    2251  tgtgcactgc gtcaataaca tacgggatct cgctacgcgt agagcctgga
    2301  gtaatgcaca gcactttggg ggaagggctt tgacatccgg tatcccggtt
    2351  gttgataagt tctactctcg gtttgttgtg tacgatgccc ccaagaagca
    2401  tcaacgtatt gacacagtga ccaacgtgca taagtggcgg ggatccggag
    2451  gggcgtacac tgtaactcct gaatctaggg ctagtttttg ggctgccttt
    2501  ggactcacgg gggatgaaca gttagcgctt gaggaccgtt tggacagatg
    2551  ggagatggat ctatttggag aggagggtgt tgacgctcat gagcccagca
    2601  tccttgactc cgccgtagca tgaccaagca agataagtta cacaatggca
    2651  atggtagtaa gaaacaacaa cacagcatta gtaccgtata gtggaggcaa
    2701  acgtggcctc cagaaagcat ttggatttgg agctacaatc gtcgggcaaa
    2751  agatttatga taatcgtggt aagattgtag ggttcatggt agaacaagga
    2801  aagaaaggtc taagtaagat ggctaatgct ctcggttatg gcaatggtca
    2851  gaaagctcag aatctggttg gtgggatggg tggggccatt atggctcctg
    2901  ttgcggtctc gaggcagctc cgtggaagta aaccccggtt tactggacgc
    2951  acagctggtt ccgttaccgt cacccaccgt gagtatgtac gacaggtaaa
    3001  caacacgtct gccttcacag tcaatggggg tattgtcggg aatttgtatc
    3051  aactgaaccc tttgaacggt actctgttca cttggttgcc ctccatagca
    3101  tccaattttg atcaatacgc gttcaataac gtcacgttgc actatgtccc
    3151  cctctgtagt accactgagg taggtcgtgt tggattatat catgacaaag
    3201  actcacagga tcctgagcct actgataggc aggagttggc gaactttagt
    3251  acccttaaag agacaccccc ctggggtgaa gtaatgttgc gaatacccac
    3301  tgataggatc aagaggtact gcgatgacag taacgcagtc gatcataagc
    3351  taattgattt gggtcaagta ggcattgcta catatggggg tgctggcgct
    3401  aacgccgtgg gtgatgtgtt tatatcgtat agcattactt tattctcacc
    3451  tcagcccact agctcattgc ttagcacaag acaacagagc cttctcggtg
    3501  ccactggtct cacgactggc ccgagttact tgacggtgtc cagcacgacg
    3551  accgttctca ccttgacgtt tagagctact ggcaccttta tggtctccgg
    3601  tcacttccgt gatactgggg cagccgtatt aggtctcgct ggtaatatca
    3651  atgtaaattc actgacagtc ttggatacgg ttggtttagc cacctcgttt
    3701  tccattaatt gttcagtgtc tgctttaccg tctaccatta cctttacctc
    3751  cacagcaata acatcttcca cggtacactg tgtacgggcc gtaagggcca
    3801  atgatgccac attgttgtaa ctgtgtgagg ggcttcttga acaagaccag
    3851  ttcatggata ctgaatacga acaagtcaat aaaccatgga acgagctata
    3901  caaggaaacg acgctaggga acaagctaac agtgaacgtt ggaatggagg
    3951  atcaggaggt agcacttctc ccttcaaact ttctgacgaa agtccgagtt
    4001  ggactgagtg gaggctacat aacgatgaga cgaattcgaa tcaagataat
    4051  ccccttggtt tcaaggaaag ctggggtttc gggaaagttg tatttaagag
    4101  atatctcaga tacgacggga cggaagcttc attgcacaga gtccttggat
    4151  cttggacggg agattcggtt aactatgcag catctcgatt tttcggtatc
    4201  aaccagatcg gatgtaccta tagtattcgg tttcgaggag ttagtgtcac
    4251  catttctgga gggtcgagaa ctcttcagca tctctgtaag atggcagttc
    4301  gggctaagca agaactgcta cagcttgccc cagtcgaagt ggagagtaat
    4351  gtatcaagaa gatgccctga aggctttaaa gccttcgaag aagaaagcga
    4401  gtaagacaga ctcttcagtc tgagtgagtg gaagcaagta ctaacctaga
    4451  tagcatgtgg gttacttgca ctggtatgca gccgttatga tgacgagtca
    4501  ggtcgggctc tacggtgggt ttggtcgccc atgggacgga gataaggaaa
    4551  gggcctcgta cgctgtaaga ctaacttcgg ttgagcttgc gatatggacc
    4601  tatgcctgga taagtcataa tgttactgcc cagtgtaaat tggatgccaa
    4651  cttacaactt taggagtact tgtggaacct catgatgaca cggttgatct
    4701  cacccttcgg gggggctata gagatcgctg gaagcactac cggacaaccg
    4751  gaacattgca gaaatgcagc cc