Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Taiwan-Pum/SP/T1, complete genome.

ACC No: JX266712

Dated: 2012-09-24 | Length: 19270 | CRC: 1883187372

                
ID   JX266712; SV 1; linear; genomic RNA; STD; VRL; 19270 BP.
XX
AC   JX266712;
XX
DT   24-SEP-2012 (Rel. 114, Created)
DT   24-SEP-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Taiwan-Pum/SP/T1, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19270
RA   Chen Y.-H., Feng Y.-C., Hung T.-H., Su H.-J.;
RT   "Genomic Analysis for Different Strains of Citrus tristeza virus in
RT   Taiwan";
RL   Unpublished.
XX
RN   [2]
RP   1-19270
RA   Chen Y.-H., Feng Y.-C., Hung T.-H., Su H.-J.;
RT   ;
RL   Submitted (03-JUL-2012) to the INSDC.
RL   Plant Pathology and Microbiology, National Taiwan University, No. 1, Sec.
RL   4, Roosevelt Rd., Da'an Dist.d., Taipei City 106, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19270
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus grandis L. Osbeck (pummelo)"
FT                   /isolate="Taiwan-Pum/SP/T1"
FT                   /mol_type="genomic RNA"
FT                   /country="Taiwan"
FT                   /note="stem-pitting severe strain"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .108
FT   CDS             109. .9477
FT                   /codon_start=1
FT                   /product="p1a"
FT                   /note="polyprotein"
FT                   /protein_id="AFS17286.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIIVLHYFGSVRITKV
FT                   IRDKSADMPIVPVRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGLPVINASGVVSPR
FT                   SVAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPCGTRSRLRRRVVR
FT                   RTDTAPAESPQDKPTRRNSRLGKTSHLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIN
FT                   FGTMTTTAWCSRSEAAVLRCRLDYHAAETDFSTQEKHIRYVYNDVSSAANRPRTVSPRK
FT                   CGSVFPSKSKLGVEVPSGRDLHTAFVRSSRASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVLMSDGVNTARLDVVAPAYYAYAKSLGAKVRFLWESSDLDDAKV
FT                   RDGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGTPAHVLIGQVRVSIPGSIVKPSRSAVRRRNR
FT                   RMRRDGFLGSSSSSSSAGESTYCSDCSSPRSLPSPSVLKPSLGRIPSIDRRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGSNFDELCHAVCSYVKRYNSRKSFYTRFESGRDYVVLRRATV
FT                   GGLHVFVKRGNFTARFPISAVRYENHYAAVMMDVGTRWVPKDCVPDVEIVKRRRSRNRR
FT                   FPLSHHAVDQSVPALQSSPVEVASVSSDKPSSSQKASSPSSSSSSSFNSIRSSDWVNVG
FT                   FSHRTTNKVREPRSVGHGRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSFLRILL
FT                   ARLSSYRPLSDEFFNKCVTSRFVACIEPVQTGLVKVHFRSDVFRASFPFGVKLYTRHAF
FT                   DIGSGGLLGLDNYGFSESLKDGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPHVFEVQHR
FT                   LERLYGKAALGYGVRGHYSAPRCFHCCYNDSPRPMASFNSYHNMGGEDNSLIITDTDRL
FT                   RAVGSAYEKVKRNIPDSLLVRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLT
FT                   RAYPEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVH
FT                   VCRPVYDVKDAHRRVVRHHQLSKVSLDQSDGVKQVGAVNTNSVCGNILGECYYASEAIV
FT                   MVQVYDVPLHELCRAMINKKSSVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQV
FT                   VYCFNNSAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISE
FT                   TKRLRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCTVVNAK
FT                   TFEWTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRL
FT                   AAFSGETSIFELVRFAISEKCRDLFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTIS
FT                   EYSELDVPINLPGFGRMVDGDETRLMEDGIKSALLRKAVRDEAQLNLKRGNTSEIVPCE
FT                   DDDDSNGDDSRVSHDSDGGSSSGGSSGGLRAGAAPSLFRCLLRKLGGGLCLAKKVLELL
FT                   LKKVVESFSRLKRKTTRLTSFANLLLARLSCGFSDDSSFSAVWEIAVNLTRIVDGVVKT
FT                   KLECFRNLFRLIPKLYVGCRDVVKDVSNAYKSAVLFSAEIFGKSYSKLCQFCLETFDVG
FT                   LIEISARNLGLETCVSMAQAIFDVLIAFPLGSVSFSVVCARVFGALAMEVGSNFLFKKV
FT                   LGKPETLGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEADA
FT                   WVGYSKHEVSSLPIVTFCVKKLSYSLEQCKEACIAFIVDSAKKILKSLTSEFNESIQNS
FT                   DLTSGAKSLYGHVSSILSTSSGVINKAGNAVATVKAVGSDIGGRVRRLRPRFSLSRHFD
FT                   EQTSEYYSASDCSELDESLLSETPGLRGNGRCRDLFRIVSRRTVACSEYLISLLKQLTS
FT                   RTGEYSYSYVMDLLVRLYVATDDVVRRCRSFTFECTDKASNFIVGCLSWYNLRSGAYSA
FT                   TPGLGGGSRSLTTVFPTGGLVRVIGALGNVLSVVFDEEFFRTLLHRLRTDVVVLLVEFL
FT                   KNLPVCLFSVYTFFECRGRVFPLREFLWGFCRFVWEIVEGLSVNVYQRLSAVVVNAYRC
FT                   AFNHRFSEEDERTLRVITEAEGRIEFLRVILAEMERFRAASNEMSLSRSSDSPSFPPTY
FT                   GEIEELNDDSSDSALVIGVDNGTGRAIVDSETDSASGSDSDVSIPLDRDFEQIGGLGGT
FT                   GNVDVFRLGLKFTLKLLRNLFNARSFKVLYGLLLQTLFYGGSVNKFVSRLVFSLGTCLP
FT                   FELFRFACSARRLFKSLASFVYQTNLFSEATVEHLFSFSRSLYDSRYFSSVFSEAERFD
FT                   FYLDHFLSLPKRYLFPSSRVRGCARAPVLVTRTEEVTPVCKRSLNDILDSLDSLKVSDL
FT                   KGKSTFVDDGESDSGSERSGSSISFGSVDEEVLNAVNGDGVCEKAPLMKHATALSKLEP
FT                   DPSGRKDIPVSKKTFTRGECSGVKSKVGMCDYLVTLNSSFGTVPDMYPVARDITYKKLT
FT                   NAMREFYYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGR
FT                   NGSHPFRSTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTF
FT                   TNEGHSLIVYEAPPGGGKTHSLVNCYADYCDKVSCLVVTANKNSQTEISQRISSELMSR
FT                   KRAAKYVTGAASRVFTVDSYLMNHLRLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVF
FT                   FGDSKQIHYIHRNDLGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICEWLSEFYPRHVAT
FT                   ANVGSVGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRTKVVPIV
FT                   NTVHEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTAT
FT                   NIDRAKEIFDKFRSTNHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGS
FT                   SVVQLGDVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVAT
FT                   RKPSVVRES"
FT   CDS             <9350. .10834
FT                   /codon_start=1
FT                   /product="p1b"
FT                   /note="RNA-dependent RNA polymerase; expressed through +1
FT                   ribosomal frameshift from ORF1a"
FT                   /protein_id="AFS17287.1"
FT                   /translation="ETLPLPTPVTYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPSDFGRAMAAAVIERCFKMEEMAKIRCDIIALTEANILKWLDKRTPCQIK
FT                   AVQAELKLPFSVEEQITNYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTEMTNAGLAEVVRRIIGDDDNYFVGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGRLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFMVQTGNKTCFIPDPYKLLVKLGAPQNKLTDDELFELFTSFKDITQDFGDQVVLEKLK
FT                   LLVEAKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNPFTKPDASDDQTDDLMTS"
FT   CDS             10883. .11794
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AFS17288.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKT
FT                   VDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAISETAINEFSVATDDVEDVKYVRKQAEGFSHCADPYPPRCYRGANLG
FT                   DSSGVQSRTIEEEGYKTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11864. .12019
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AFS17289.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12025. .13809
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AFS17290.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGAKSVP
FT                   VPYLSPLNNDFGLSVALPSLIALYTRSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELAEFLPQKELNVSSLKEALSLQTDPVKYTVTNYG
FT                   ISETVSIDQTTLREIASVFITRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTRVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13733. .15340
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AFS17291.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVEFTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTMVFT
FT                   KNYDSSVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLVPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEHVVESDALDDLSQHVDVRLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAADREVERPALFRLPQKLLNQDDGESCSLCMSSVEALFSL
FT                   VQKVNRDINIRRQFMGRHSKVALRLYRSLGLKFPPISSVRLPAHHGHLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRPGRGSSRTFRGRGARGASSRHLSRN
FT                   VATSGFNLPYHGRSYNTS"
FT   CDS             15315. .16037
FT                   /codon_start=1
FT                   /product="p27"
FT                   /note="minor coat protein"
FT                   /protein_id="AFS17292.1"
FT                   /translation="MAGHTILPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VINKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYV"
FT   CDS             16130. .16801
FT                   /codon_start=1
FT                   /product="p25"
FT                   /note="coat protein"
FT                   /protein_id="AFS17293.1"
FT                   /translation="MDDETKKLKNKNKETREGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRHTRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKLNT
FT                   R"
FT   CDS             16767. .17270
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AFS17294.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFISGWWSFIVNVGDIIVRFALHVPSE
FT                   EMLNGFSAISNCTIIADGSALLKDNTVVDRLEGVNPLAHLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDTRCGCSIWFYNNGMFRNGLTRCDNLVTL
FT                   FSAT"
FT   CDS             17304. .17663
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AFS17295.1"
FT                   /translation="MGIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDAHFS
FT                   NISYAKKCYDLANFDLDFLRVVVIPLSGSTANESRADRANISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCGN"
FT   CDS             17739. .18287
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AFS17296.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAEKERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQEGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSAVD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKVVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18368. .18997
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AFS17297.1"
FT                   /translation="MDSTSGQTFVSVNLSDESNTASTAVRTVSSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKGKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEF
FT                   YKFGITAKAMLPNINAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
FT   3'UTR           18998. .19270
XX
SQ   Sequence 19270 BP; 4716 A; 3815 C; 4846 G; 5893 T; 0 other;

jx266712 Length: 19270  24-SEP-2012  Type: N  Check: 1977  ..

       1  aatttctcaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttaaacttat gtcgaaactc agaggaagct tctggtcttc ggccatcgct
     151  gttaacagcg attacacgat atcgcgcatc tggcgcaaac ttaacaccat
     201  aatagtcctg cactattttg gttctgttag aatcaccaag gtgattcgtg
     251  acaaatcggc tgatatgccg atagtccctg tacggaaatc tgtatttccg
     301  ttttctgttc gcgcggctgt ccgcgcaatt cgtgctgccg ggcgtcctct
     351  cgacgctccg cattcagggt gcctctgtgg ccttcccgtt atcaacgcat
     401  ctggcgttgt tagtccccgc tctgtcgcgg gtttttcgag gttttctctg
     451  tgcaaacctc cgctcacctc tgccgctaag aggtccctcc gtcaggctaa
     501  gcgggaatct gtttcccttt ctagccgggc ctcctctcgc ttctctaggg
     551  aagtcccttg cggcacacgt tcaagacttc gcagacgtgt ggtgagacga
     601  actgacactg ccccagctga aagtccccaa gacaagccaa cccgaagaaa
     651  tagccgactt ggtaagactt ctcacctccc ttacatgggg gaggcagcgt
     701  tggatgatat ccttcgctgg atcgaagggg ttaatcccca tccctcgatg
     751  gtcgctattc cagtgcccat caattttgga accatgacta caacggcatg
     801  gtgttcccgt tctgaagccg cagttttgcg gtgccgcctt gactatcacg
     851  cggctgaaac tgatttctcc actcaggaga aacacatacg gtacgtctat
     901  aatgacgtat cttctgccgc taaccgtcct cgtacggttt ctccccgcaa
     951  atgcgggtct gtttttccca gtaaatctaa actgggcgtt gaggtcccct
    1001  ctggtaggga ccttcacaca gcgttcgtga gatcttctcg cgccagcgct
    1051  tttttctctg acgcggttcg ccgcgttcgt ctgttccgcc cagcgcggaa
    1101  caattttttc acttccgtcg tcagcggacg acgcgtttgc tactacagac
    1151  ccggtccgtg tggtacggtg tctgttttaa tgtcggacgg cgttaacaca
    1201  gcacgtctcg acgttgttgc tccggcgtac tatgcgtacg ctaaatcttt
    1251  gggcgccaaa gtgcgctttt tgtgggagtc gtcggactta gacgacgcta
    1301  aagttcgtga cggtcaatgt tatgtccgtc atgtgttcga cgtggctctc
    1351  tactttggga gacgcgccga cctttccgtg cgtagagcac tgggcatgta
    1401  ccccacagtg ggcgcattaa aagcttatct tgttcgcgag tacggtcgcg
    1451  attctcttaa ggttcctatg cgtgggacct acacttttgg cagcgtgttt
    1501  cactgcctgt cgactaaatc ttcagtcgac ttgcgatcta ttcctaacca
    1551  tcatttagtt ggtgggacgc ctgcccatgt cttaattggg caggttcgag
    1601  tcagtattcc tggctcaatt gttaaacctt cacgttcggc tgttcgtagg
    1651  cgtaatagac gcatgcgacg tgacggtttt ctcggtagtt ccagttcttc
    1701  ttcttctgcg ggggagtcga cttactgttc ggactgctct tctcctcgca
    1751  gtttaccatc tccctccgtt ttaaaacctt ccctaggtcg gatcccgagt
    1801  atagatcggc ggtttcggtt tcctgcgggt acgcagttac gcgtctccgt
    1851  acctaggcgg gtcgatgacc atgtttacgt gtcgactggt agcaacttcg
    1901  acgagttgtg ccatgcggtt tgctcgtacg tcaaaaggta caactctagg
    1951  aaatcctttt acactcgatt cgagagcgga agggactacg tggttttgcg
    2001  gcgtgctacc gttgggggtc ttcacgtgtt tgtaaagcgt ggcaacttta
    2051  ctgcccgatt tcctatttcg gcggtcaggt atgagaatca ctatgccgcg
    2101  gttatgatgg atgtggggac tcgttgggtt ccgaaggact gcgttcccga
    2151  tgttgagatt gtgaaacgtc ggagaagtcg taatcgtcgt tttcctcttt
    2201  cccatcatgc ggtggatcag tcggtccccg cgttacagtc gagtcctgtc
    2251  gaggttgctt cggtttcgag tgataagcct tcatcgtcgc agaaggcttc
    2301  ttcaccttct tcttcttctt cttcttcttt taactcgata aggagttcag
    2351  attgggtgaa tgtcggtttc tctcatcgaa ctactaataa ggttcgtgaa
    2401  ccgcgttctg ttggtcatgg taggatcgga aatttcactt tcccgagggg
    2451  cactgtgtac aacacacctg tcgatgaacg cgcctataaa cgtgttctta
    2501  gattgcgaga taccacagcc tgttcctttc tccgcatact gctagctcgt
    2551  ttgtcgagtt acagaccttt aagtgacgag ttctttaaca agtgtgtcac
    2601  ttcccggttt gtcgcgtgca ttgaacccgt gcaaacgggt ctcgttaagg
    2651  tacatttccg ttctgatgtt ttccgtgcct ctttcccgtt tggggtcaaa
    2701  ctatacaccc gccacgcgtt tgacattgga agtggtggtc ttttgggttt
    2751  ggataattac ggcttttcag aatccctgaa ggatgggtat tgctacattc
    2801  gccatttcgc cgaagttagc ttgagcatgg ggcgaatttt cttcaggagg
    2851  gacgtcgact tgggaccttt cccacacgtt ttcgaagtgc aacaccgtct
    2901  tgagaggttg tacgggaaag ctgcgttagg atacggtgtt aggggtcact
    2951  attcagcccc acgctgtttt cactgttgct acaacgattc accgagaccg
    3001  atggcgtcct ttaatagtta ccataatatg ggcggcgaag ataactccct
    3051  gataatcaca gataccgaca ggttgcgtgc tgtggggagt gcctatgaaa
    3101  aagtgaagag aaacatacca gattcgttat tggttcggtc tgtagaaaag
    3151  gaccttatag agtttaatca gactctagtc gacatgcatc gatccagacc
    3201  gggcgttgtc gtacctttcc aaatgagtga gaaccagcaa gtgatgctta
    3251  ctagggcgta cccggaattt aatattaatt ttattcattc cgtacattcc
    3301  gatcatccgg tggccgcagg ttctagggcg ttggagaatc atctcgttcg
    3351  taaacacgct ggtaccgatt attcggatgt ggggggttgt ccgctgtttc
    3401  atttacgtgc gggtcactcc ggcgttcacg tctgtagacc ggtgtacgat
    3451  gttaaagacg ctcatcgtag agtagtccgt catcaccaac ttagtaaggt
    3501  ttcgctagat cagagtgacg gtgttaaaca agttggtgcc gtaaacacga
    3551  attccgtatg cggtaacatt ttgggagagt gttattatgc atcggaggcg
    3601  atagttatgg ttcaagttta tgatgtaccg ctacatgagt tgtgtagggc
    3651  tatgataaac aagaaatctt ccgtgtgtta tatgaccatg gttacgcctg
    3701  gtgagttgtt ggatgcccgt gagtcctttt ttattaagga cttagattgt
    3751  tcggtcgagt tggatcccgt cgcggaccag gttgtttact gtttcaacaa
    3801  ttccgcgtat acgcacacgt actccactat atgtgagtat atgcgtactc
    3851  cttgcttggt ggtggatggg tttttgttta ctattgagat ggtgtcgctc
    3901  aggtgtagtg ttaattacta ttgcatcact aaatcgtcgg tttgtccaag
    3951  aattagtgag actaagcggt tacgctaccg tcggtgtgac agcgacttga
    4001  tcagaatcaa gattccccgg tactctagta aaacccgtag ttgtttacct
    4051  gggtgttact atttgtactt ggacgccaag ttcgtaagtc gcgtgtacga
    4101  gtacgtggtc aataattgca ccgtggtgaa cgcaaaaact tttgagtgga
    4151  cttggaatta catcaaatct tgcaagtcga gagtggtgat cagcgggaag
    4201  attatacacc gagatgttcc gatcgcttta gagtacttag acgggttttc
    4251  tgctgttatg ttgtccgctg gtgtgaaggg taggcaaaac gcggaagcgt
    4301  tttctagacg cttagccgct ttttcaggtg aaacttcaat ttttgagtta
    4351  gtgaggtttg ctatttccga gaagtgccgc gacttattca tgggtattca
    4401  ggacgctgtg gaaagatgcg tgaaatcgta ccttaggaac tcgtttaaca
    4451  tgagtttcgt ggacttgtcc gatcccttac ttacgattag cgaatattcg
    4501  gagctggacg ttcctatcaa cttaccaggt ttcggtagga tggtggatgg
    4551  tgacgaaact agacttatgg aagacggtat taaatcggca ttattgcgga
    4601  aagcagttcg agacgaggcg cagttgaatc ttaagagagg taacacttcc
    4651  gaaatcgttc cgtgtgagga cgatgatgac tcgaacggtg atgattcacg
    4701  tgtttcgcac gattcggatg gtggttcgtc ttcgggcggt agttccggcg
    4751  ggttgcgagc tggagctgcc ccttctttgt ttaggtgttt actcaggaag
    4801  ctgggtgggg gtttatgttt ggcaaagaaa gtgttggaac tgttactcaa
    4851  gaaggtggtt gagtcgtttt cacgtctgaa acgaaagacc actcgtttaa
    4901  cgtctttcgc taatttgttg cttgcgaggc tttcttgcgg gttctccgat
    4951  gattccagtt tttctgcggt ctgggaaatt gcggtcaatc tgaccaggat
    5001  cgtcgatgga gtagttaaga cgaaattaga gtgctttcga aatttgtttc
    5051  gattaattcc taagttatat gttggttgta gggacgttgt gaaggacgtt
    5101  agtaacgctt acaagtcggc tgttttgttt tccgctgaaa tttttggtaa
    5151  gagttactct aaactttgtc agttttgctt ggaaacgttt gacgtggggc
    5201  ttattgagat ttccgctcgt aatttgggat tagaaacttg cgtctcaatg
    5251  gcacaggcta tttttgatgt gttgatcgct tttcctttgg ggagcgttag
    5301  cttttccgtc gtttgtgcta gggttttcgg tgctctcgct atggaagtgg
    5351  gatcgaactt cttgtttaag aaagttttgg gtaaacccga aactctaggt
    5401  gaagatgcct tccgtaggac cgtaagtatg gttttgagcg ccaaagcgtt
    5451  tgacaagctt tccgtagatg cgaaaggctt agttaggtgc tctggtgtta
    5501  ttcctggggt gttaaggata atactatctt ccttgttttc cgaggcagac
    5551  gcttgggtgg gttacagtaa acatgaagtt tcttcccttc ccatagttac
    5601  cttctgcgtg aagaaattgt cttattcttt ggaacagtgt aaggaagcgt
    5651  gtatcgcttt cattgtcgat tctgctaaga agattctgaa gtctttaact
    5701  tctgagttca acgaatctat tcaaaattcc gacttgacta gtggtgctaa
    5751  gtccttgtac gggcacgtga gctcgatact ttccacctct agcggtgtga
    5801  ttaataaagc cggaaacgcc gtcgctaccg ttaaagcagt cgggagtgat
    5851  attggtggtc gtgtgagacg cttgcgaccc cgtttttctc tctcccgtca
    5901  ctttgacgag cagactagtg aatactactc tgctagtgat tgttccgaac
    5951  tggacgagtc gttgctcagt gaaacacctg gtcttcgtgg aaatgggagg
    6001  tgtagagatt tatttcgtat cgtatctaga cgcacagtag cgtgtagtga
    6051  atacttgata agtcttttga aacagttaac atcgcgtacc ggtgaatact
    6101  cctactcgta tgtgatggat ttgcttgtga ggttgtatgt tgcgacagac
    6151  gacgtcgtta ggcgatgcag gtcctttaca ttcgaatgta ctgataaagc
    6201  gtccaatttt atcgtcgggt gtctcagttg gtacaacttg cgttctggtg
    6251  cctactctgc aactcctggg ttgggtggtg gtagtagaag tttaacaacg
    6301  gtttttccca ccggtggttt agtgcgcgtt attggggcac ttgggaacgt
    6351  cttatcagtg gtgtttgatg aggaattctt taggactcta cttcatcggt
    6401  tgaggacaga cgttgtggtt ttactggtgg agttcttgaa aaaccttccc
    6451  gtatgtttgt tttcagtata cactttcttt gagtgtcggg gtagggtttt
    6501  ccctttgaga gagttcctat ggggcttttg tcgtttcgtt tgggaaatcg
    6551  tcgaagggtt gtccgtcaat gtctatcaac gtctctctgc tgtcgttgtg
    6601  aatgcgtatc gatgtgcgtt caatcatcgg tttagcgaag aggatgagag
    6651  gacacttcga gtgatcacag aggcggaagg aagaattgag tttttgcgag
    6701  ttattctcgc ggaaatggaa aggttccgtg ctgcgtcaaa cgagatgtct
    6751  ttgtcgaggt catctgatag cccttcattc ccacctactt acggagaaat
    6801  tgaggaattg aatgacgatt cctccgacag tgcactagtg ataggtgtgg
    6851  acaatggcac cggccgtgcg atcgtcgaca gtgagaccga ttctgcgtct
    6901  ggtagcgaca gtgacgtttc tattccgttg gatcgcgatt ttgagcaaat
    6951  cgggggtctt ggtggaaccg gtaacgtcga tgtctttcgg ctgggtttga
    7001  aatttactct gaagttgttg cgcaaccttt ttaacgctag aagttttaaa
    7051  gtgttgtacg ggttgttact tcagactctt ttttatggtg gttcggtaaa
    7101  taaattcgtg tctcgtttgg tctttagtct tgggacttgc ttaccttttg
    7151  agttattccg gtttgcgtgt tcggcgaggc ggttgttcaa gagtttggca
    7201  tcatttgttt accaaactaa ccttttcagc gaagctacgg tggagcattt
    7251  gtttagcttt tcccggtcac tttatgattc ccggtacttc tcgagtgtgt
    7301  tttcggaagc agagagattt gatttctatt tagatcattt cctttcactc
    7351  ccgaagagat atcttttccc tagttctagg gttcgaggtt gtgctagggc
    7401  tccagttctt gtgactagga ccgaagaagt gacaccagtc tgtaagagat
    7451  cattaaacga catattggac tctttggatt ctctgaaggt gtcagacctc
    7501  aaagggaagt cgacattcgt tgatgatggg gagtcggatt ccggtagtga
    7551  acgttcgggt agttcgatct cgttcggttc cgtcgacgag gaagtcttaa
    7601  acgcggtaaa cggtgatggc gtttgcgaaa aagctccgtt gatgaaacac
    7651  gctaccgcgc ttagcaagtt ggaacccgac cctagtggtc gtaaagatat
    7701  tcctgtttcc aagaaaacct ttactcgtgg tgagtgttcg ggcgtgaagt
    7751  cgaaggtggg catgtgtgat tacctggtga ccttgaactc ttcgtttggt
    7801  acagtacctg acatgtaccc tgttgcgcgt gacataacgt ataagaaact
    7851  aactaacgcc atgcgcgagt tttattactc gcaaaaaata accttgtacg
    7901  aacttcacgg aaagttgagt tcttattggg acgagttgaa ggttgcaggt
    7951  ttcgatagaa agttgacgag aatggacttg gacgatgatg tctatgttgt
    8001  tgatttcaat cggaagctgt tggtggggag aaatgggtct catccgtttc
    8051  gtagtacgtt aaagtcctat tgttttatgt tctgcaatga tgggttggtt
    8101  ccttgcccgg gttctcagaa gtatgattat gctttgattt ctaatcaaac
    8151  gtcttttgtt gccgcgaact cgttcttacg tgctgtggat ggtaaagatt
    8201  tgacttttac caatgaggga cacagcctta ttgtttatga ggctcctcct
    8251  ggtggtggta agactcattc tttggtgaat tgttacgcgg attattgcga
    8301  taaagtatct tgtttggtag tgacagctaa taagaattct caaactgaga
    8351  tatctcagcg tatatctagt gagttgatga gtaggaagcg agctgctaag
    8401  tacgttactg gtgcggcttc tagagtgttc actgtggact cttacttgat
    8451  gaatcatttg cgacttacga ctcagttgct gtttgtcgat gagtgcttta
    8501  tggttcacgc tggggcaatc ggtgccgtgg ttgaattcac gtcttgtaaa
    8551  gcggtagttt tctttggtga cagcaagcaa atccactata ttcaccgaaa
    8601  cgatctcggg gtctctttgt tgcatgatat tgatgcattt atccaaccgg
    8651  agcatcgtat ttacggcgaa gtatcctata ggtgtccttg ggacatttgt
    8701  gagtggcttt ctgagtttta cccgcgacac gtagctactg ctaatgtcgg
    8751  gagtgttggg aaatcgagcg tgtcgataga ggaaatcaat gggtgtgatg
    8801  acgtacctta cgacaaggca gcgaagtaca ttgtgtacac tcaggctgaa
    8851  aagaacgatc tgcaaaaaca tctcggtcgt ttaaccgtgg gtcggaccaa
    8901  agtagtaccg attgtgaata ccgttcatga ggttcaagga gagacttata
    8951  aaagggtacg cctggtgagg tttaaatatc aggaggatac cccgttttct
    9001  tcgaagaatc atattgtggt tgctttgact agacatgttg attctttggt
    9051  ttactccgtg cttactagta ggaggtacga cgatactgcg actaacatag
    9101  atagggcaaa ggaaattttt gataagtttc gttcgacgaa tcactcgtac
    9151  ggttcgtcat cgttagaatg gtaccttgaa aaatttccta ccgaatataa
    9201  aggtagtaag gcatcctctg ctccgataag ttgcattaac gaattcctta
    9251  atgaggtggt cgttggttct tctgtcgtac agttgggtga cgtgtctgaa
    9301  gaactgagtt cacgtccctt tgaatcaggg tgtgataatg ttaccgtaag
    9351  agacactgcc cctcccgact ccggtaactt acacgaaccg gctcgcgttc
    9401  ggcgtagtaa ggtcacaagc aattcctcca agaaaagcgt cgctacaaga
    9451  aaaccttctg tcgtacgaga gtcgtaatta caactttatc aagacagaac
    9501  ggtttgttgg accgagcgat tttggtaggg cgatggctgc tgccgttatc
    9551  gaacgttgtt tcaaaatgga agagatggct aagataaggt gtgatattat
    9601  agcccttacc gaggctaaca ttttgaaatg gctcgataag cgcactcctt
    9651  gtcaaataaa ggcagtgcaa gctgagttga agcttccctt ttcggtggag
    9701  gagcaaatta ccaattacaa actgatggtt aaacgtgatg ctaaggtaaa
    9751  acttgacgac tcgagcctat ctaaacatcc cgctgcccag aacattatgt
    9801  ttcacaagaa gtttattaac gccatatttt ccccatgttt cgatgagttc
    9851  aaaaataggg tgttgtcctc acttaatgac aatatcgtat tctttactga
    9901  aatgacgaac gctgggttag cggaagttgt cagaagaatc attggtgatg
    9951  acgacaacta ttttgttggg gaagtggact tcagtaagtt cgataagtct
   10001  caggatttgt tcattaagga gtacgaacgt acgttatatt ccgagtttgg
   10051  gtttgatacc gaacttctcg atgtgtggat ggaaggtgag tatcgcgcta
   10101  gggcgactac tttggatggt cgactgagtt tttcagttga tggtcagcgt
   10151  cgttctggag gttcgaatac ttggattggg aattctttgg tcactctagg
   10201  cattctctcg ttatattacg acgtttcaaa gtttgagtta ctcctcgttt
   10251  ccggtgacga ttctttaatt tattcaagtg agaagataag taacttttct
   10301  tctgaaattt gcttagaaac aggctttgag actaagttta tgtctccgag
   10351  tgtgccgtat ttttgttcaa agtttatggt tcagactggt aacaaaacct
   10401  gttttatacc tgacccttat aaattgttag taaagttggg ggctccacaa
   10451  aacaagttaa ccgacgatga gttatttgag ttgtttactt cttttaagga
   10501  cataacacag gactttggtg atcaagtggt tttggagaag ttgaagttgc
   10551  tagtcgaagc taagtatggg tttactagcg gaactactat gcccgctctg
   10601  tgtgctatac attgtgtacg gtccaattac ttatccttcg agaggttgtt
   10651  tccttttatt aggggttggt atgttgtcga tgctttgaag cttagacaac
   10701  taaggaagtt cgccaattta atctgtgaac gcgtggttta cgataatcgc
   10751  gtgggttatt tttcgtactt tgacaatccg tttactaaac ccgacgctag
   10801  cgatgatcaa acggacgact tgatgactag ttgatcgttt gttcagttct
   10851  cgctgagagc cgacgttggt agttgagtcg agatgtttgc tttcgcgagc
   10901  gaaaaccaag acttattaga agaaaagata tttcgtcgta gaacgtacca
   10951  tcgtaagtat ttcgatgacg tggttaggga tttcactatt gatgttggtt
   11001  ataacgttga tgatcgtgac cctacggtgt tggctgacta tttctcgttg
   11051  tatttctttt tgcttaacaa cgataacgtt gggcctttag cagcttcaat
   11101  tgtagtgagc ccgccggtta gcgggactta taaaattcga gcgcacgtcg
   11151  ataatcaacc gaattgcgaa ggaaacgtga cttacgttaa gactgtcgat
   11201  aagaaccgtt ttgcgattct cataaaagca gtcccggctc caatgagagg
   11251  ttattactct tttcgggcgt ttcttactga taatgtcact agcgaacgca
   11301  gtgaattcat atgcagtttt atcggtagta gattcctttg ttgttgtacg
   11351  caaacgatat ccgaaaattt gagtaaggtt tgttcgtcct ctttctcttt
   11401  tagagcaatc tcagaaaccg cgattaacga gttttctgtt gcgactgatg
   11451  atgtagaaga cgtcaagtat gtgagaaaac aagccgaggg tttctcacat
   11501  tgcgctgacc cgtaccctcc taggtgttat cgcggcgcta atttaggcga
   11551  ttcttcaggg gttcaaagtc gtacaatcga agaagaaggt tataagacgg
   11601  ataccgcagg taacgtcgcg gtcactatcc cgaacacccc acttgttagt
   11651  gctgtctctc cgtatgtcgc agagtacaac gaaaatacgc gttcgcgtat
   11701  ctcgttaata cgccgagtct gctgttacgc cgtttgtgtt ttagtggtgt
   11751  ctcttcttat aatgagcggt ttgttagcca ttatattcat atgatttgat
   11801  gtagtaactt acgaggtaca attaactaga actcgccgtt tgactctgtt
   11851  taaacgggtt tcaatggact gtgtgattca aggatttctg acttttctgg
   11901  ttggtatagc tgtgttttcg gcctttgccg gactgattat cattgttata
   11951  acgatttatc ggtgtacgac taagcctgtt agaaatacct ctccttacgg
   12001  cactcacgcc actgtctaag cagtatggta ctcctgggtt tagactttgg
   12051  taccacgttt tcgacggtgg ctatggctac gtcttctgag ttagttatac
   12101  tcaaacaatc taattcatcg tatataccca cgtgtttgtt tctacatgca
   12151  gatcctaaca gcgtgtctta tggttacgat gcggagtatt tagcggcttc
   12201  aggggaaccc ggctcgtttt acaaagattt gaaacggtgg gtcggttgta
   12251  ctgagaagaa ttaccaaagc tacttgcaca agttgtcacc atcttataag
   12301  gtgatagtga aagagtttgg agctaagagt gtgccggtcc catatttgtc
   12351  acctttgaat aatgactttg ggctcagcgt tgctttgcct tcactgatcg
   12401  ctttatacac caggtccatt ttatcggatg cggaaagagt gtttaacgtg
   12451  agttgtactg gtgttatatg ttcggtacct gctggttata atacgttaca
   12501  gcgagctttt acgcaacaaa gtgtatcctt gtcgggttac tcttgcgtgt
   12551  atattattaa tgaaccttct gctgccgctt actccacttt acctaagttg
   12601  agttcggcag acaagtattt ggccgtttac gacttcggcg gtggaacctt
   12651  tgatgtttct atagttagcg ttagattacc cacgttcgct gttagaagtt
   12701  caggtggtga tatgaactta ggtggtagag acattgatag aaaattgtct
   12751  gacaaaatat atgagttggc tgaatttcta ccgcaaaaag agttgaatgt
   12801  atctagccta aaggaagcct tatctcttca aacggatccg gtcaaatata
   12851  ccgtaactaa ttatgggatt agtgaaacag tatcaatcga ccaaacgact
   12901  ttgagggaga tagcttcggt gtttataact cgaacgatag acatacttac
   12951  acaagttaag gttaagtcta gcatgcccga gtcgcaaagc ttgaagctag
   13001  tggtagtcgg tggaagctcg tacctaccag ggttgctgga tactttggaa
   13051  actgtacctt ttgtgtctgg aataatacca gtggaagacg caaggaccgc
   13101  cgttgctaga gggtgcgctt tatatagcga gtgcttggat ggtaggtcca
   13151  aggccttatt aatagattgt atcacgcatc atttatcggt cacgacattt
   13201  agtgcagact cggttgttgt tgctgcggcc ggaagtccaa ttcctttcga
   13251  aggagaacga aaactcacgt tacgtaagtg cgttagtacg tctaattatc
   13301  aagcgaggat gttcgaagga gattacgaaa aggttttccg aaatgagcgt
   13351  atatacgcag cttcggtatc attgtttact ttaggagtta actggcgcgt
   13401  gcccaacgac gttgagatga ctctcgtgac cagagtggac tcaatgggta
   13451  aagtggaatt ctaccttaaa ggtccatctg gtgagttagt taacgtgcaa
   13501  ggtacttcac attatgatta tgttggtatg cctcatccta ctaggaagtt
   13551  gttgaggctt agcgattaca atgtaaactc cgcagcttta gttttagctt
   13601  tgacgttgac tcgcgaaaaa cgagaaaaat ttcttttgcg aacgttattt
   13651  gatgctttac tagcagactt acgaaagacc gcaagcttaa gcgaatattc
   13701  taagaaatac ccgatcactc gaaacgacat cgatgtcgtc tcatcacgta
   13751  tggggatcgt tgtttcgaaa gttttacggg gaagcgattt ggaaagaata
   13801  cctctctgaa tcaactcgaa atttcgatga gagaaacgtg tcgttggacc
   13851  acactctgag ttcgggtgtg gtcgtccgta ggcagagtct tttgaacgca
   13901  cctcaaggga ctttcgagaa cgagttagca ctattgtaca attcggtggt
   13951  gattaatgac ttcgttgagt tcactggtat gccgttgaag tccttgatga
   14001  caggtatcga ggaccgtaag gtgcctgacg agttaatatc cgttgacccg
   14051  catgaagttg gatgtaaatt tacgttaaat gacgtagaat catatctaat
   14101  gagcaggggt gaagattccg ctgatgtgac ggcggtcgag cactcgtggt
   14151  gtttgagtaa ttcttgcggt agattattaa gttcgactga gatagacgct
   14201  tacaaaacca tggtatttac taagaattac gatagtagtg tatctggggt
   14251  gactactaag ttagagactt atttatcgta ctgcatatcg ttgtacaaga
   14301  aacattgcat gaaagacgat gactatttca atcttatctt acctatgttt
   14351  aattgtttaa tgaaagtgct ggcatcgctt ggtttgtttt atgagaaaca
   14401  tactgacaat ccgctactga ccggcatgct catagagttt tgcttagaaa
   14451  ataaggtgta ttactctact tttaaagtaa atttagacaa cgttagattg
   14501  tttaagtcta aagtgttgcc tgtggtgtta acggtttggg atatatctga
   14551  gcctgatgac ccagtggatg agagggtact agttcctttc gatcctacgg
   14601  atttcgtgct cgatttacct aaattgaata tacacgacac gatggtggtg
   14651  gtgggtaatc aaatcagaca gttagaacac gtagttgaga gcgatgcttt
   14701  agacgattta tcacagcacg ttgatgtacg tttagcagcg gacaatcccg
   14751  atctacgcgt cgatctgcgt tgggcaggaa tgtttgtgta ttacggtatt
   14801  tatcggtgtg ctgctgatag agaggtagaa cgaccagcgt tatttagatt
   14851  accgcagaag ttattgaatc aggatgatgg tgagtcgtgc tcattatgca
   14901  tgagttccgt cgaagcttta tttagtctgg tgcagaaggt gaacagggac
   14951  ataaacatta gacgtcagtt catgggacgt catagtaaag tggctttgcg
   15001  gctgtatcgc agcttaggtt taaagtttcc accgatctct tcagttaggt
   15051  taccagctca tcacggtcat ctatacgttg atttttataa aagagtgcct
   15101  gatgacgctg ttaccgccga cgaactcgag agtttacgtc aactacgttc
   15151  gtccgtggac gtcatgtgta aggacagggt gtcaatcaca cctccaccat
   15201  tcaatcgacc tggaagaggt tcttctagaa cattcagagg tcgaggcgca
   15251  cgcggtgcga gctcgcgtca tttgagcaga aacgtggcga cttccggttt
   15301  taatctaccc tatcatggca ggtcatacaa tacttcctaa aactgatgat
   15351  aaagaaatgg atccggtgag tgccgctgta cccggtaagt acccggatgt
   15401  tattgaaaaa tttgtggcaa ataggtctgt agatgcgtta atagaaggcg
   15451  ttataaataa gttggatacc aattcgatat acgaagattc cactgaaaag
   15501  ttcactggtg agtacttaaa gtacgttatg gttactatgg acactttctt
   15551  attagaaaac tataaaacga aaacggaaga tctgttagtt cacttagcta
   15601  tgatccaaaa gaggttatgc accatatcca cgagtactaa aactaagttc
   15651  cgcgataagg gttgtattag ttacgtacaa ggaggtttac gatacaagtt
   15701  attggataaa gtggtttttc cttttattat atcgaaattt accgacaggg
   15751  agactccgaa tgctctacgt aagtatgctt gcactttcga ggagttacac
   15801  ttatgtatgg ctagattaag acccgaccta tacgagaata aaaggacgac
   15851  caaggctggg actccacatt taaaaggtta cttatcagct gactttcttt
   15901  cgggttctct cccagggtac tctgagcatg aacgaggcat tattcttcga
   15951  gcgtccgaat ctatgttagc tagacgtcaa ggttacgagg aggcaaccga
   16001  gcttcttaac ctacgtgatt tgggtaagta cgtttagttg attttgggcg
   16051  gtaatatcat accatccctt gagcgctgct ttaagggtcg ttaatcgacg
   16101  actcttgata tatttactag gtttgaataa tggacgacga gacaaagaaa
   16151  ttgaagaaca aaaacaagga aacgagagaa ggcgacgatg ttgttgcagc
   16201  tgagtcttct ttcggttcgt taaacttaca catcgatccg actctgatag
   16251  cgatgaacga tgtgcgtcag ttgggtaccc aacagaatgc tgctttgaat
   16301  agagatttgt ttcttacctt gaaagggaag tatcccaact tacctgacaa
   16351  agataaagac tttcacatag ctatgatgtt atatcgttta gcagttaaga
   16401  gttcatcatt acaaagcgac gatgatacca cgggtgtgac gtacactcgg
   16451  gaaggtgttg aagtggagtt gtctgacaaa ctttggacag acgtcgtgtt
   16501  taactctaag ggtattggta accgtactaa cgcccttcga gtctggggta
   16551  gaactaacga tgccctttat ttggcttttt gtagacatac ccgcaacttg
   16601  agttatggtg gacgtccgtt agatgcagga attccagccg ggtatcacta
   16651  cctgtgtgca gatttcttga ccggagctgg cttgactgat ttagaatgtg
   16701  cagtgtactt acaagctaaa gagcaattat taaagaagcg aggggctgat
   16751  gaggtcgtag ttactaatgt caggcagctt gggaaactta acacacgttg
   16801  atttattgcg ttctgattct cgattcatat cgggatggtg gagtttcatt
   16851  gtgaacgtag gcgatataat cgtccggttt gcgttacacg ttcctagcga
   16901  agaaatgctg aatggttttt cagctatatc gaattgcaca atcatagcgg
   16951  acggtagtgc tttactaaaa gacaacaccg tagttgatcg tttagaaggc
   17001  gtgaacccct tggctcattt gttaaaatta gcgaaaacga ctactactat
   17051  ttgttttact atgtctaata aggttctttt tggtactact aaatccgaac
   17101  cgcttagttg tttagccatt acgtcggatc gagttttatt caaagttgtt
   17151  atgggtacaa acgttgatga tactcgatgc ggttgcagta tctggtttta
   17201  caacaatgga atgtttcgaa acggattgac ccgttgtgat aatctcgtca
   17251  ctttgtttag tgcgacttag acacgaagtg gccgttagga tttaattgct
   17301  gcaatgggta ttcgacgtgt gtggttaaag gttgtggctg taattacggt
   17351  attatggtac ggtaaggaac cttctattag tgaaggttac aacgctctta
   17401  tgaatgatga ctttaagttt atcgacgcgc atttttcaaa catttcttat
   17451  gctaagaaat gttacgattt ggctaatttc gatttagact ttttacgcgt
   17501  cgttgtcatt cctttaagcg gtagtacggc gaatgaatcg cgtgctgatc
   17551  gcgctaatat ttcagaaatt gtcgaatcac atgtaagcga ccgagacaga
   17601  atgaacattt tgttgcgtaa caagcggatc caaatcccat cgctcttacc
   17651  ttgcggtaac tagagtctac tcagtagtac gtctactagt ataacgtatt
   17701  gaacacttta gtaaaggatt ttgtttgaac caaacaatat gcgagcttac
   17751  tttagtgtta acgattacat aagccttttg gctaaagtcg gcgcggaaaa
   17801  ggaacgtttg tgcgatccca gcgtaactct tacggaagtg atggacgaga
   17851  ttaatgactt taactcgttt ctcgctttgg tgcactctat gaaatcagac
   17901  atgaacggag accatcagga aggccaccat gagatgggtg aacacaagtc
   17951  tcgattgtta tgcaatatag aggcgaaatt gcgagtactt ctcgacatta
   18001  taaggcgtcg gttcactcgc gaaaagctgc tttgtaccag tgcggtagat
   18051  gtcatgggct ttttcgttat gaggtacatg agctccagcc acactagctt
   18101  cgagtctgta atgagaacag agttgaagtt agtggttaag gtggtactgt
   18151  cggatctgtc ccgtgcgcat aagttggatt ttagcgagcg agcttttgct
   18201  gcttacggta tccttttgca aaagggtact gtgtcgaccg tttgcggtca
   18251  gtttgacatt aatttagtgt ctccgtcttg cgtgtaggtt aatacgtttc
   18301  tcagaacgtg tggttgtatt aactaacttt aattggaaca agtttattgt
   18351  aaagtctgcg agttacaatg gatagtacta gcggacaaac tttcgtttct
   18401  gtgaaccttt ctgacgaaag caacacagca agtactgcag ttagaaccgt
   18451  aagttcggaa gctgatcgct tggaattttt acgaaaaatg aaccccttta
   18501  tcatcgacgc tttggtacgg aaaaccaatt atcagggtgc tcgctttcgc
   18551  gcaaaaataa taggagtatg cgtagattgt ggtagaaaac acgataaggg
   18601  gttgaagacc gaacgtaaat gtaaggtcaa taatacacag tctcagaacg
   18651  aggtggcgca tatgttaatg cacgatcccg ttaagtattt aaataaagga
   18701  aaggctagag ccttttctaa cgcagagatg tttgcaatcg atttggttat
   18751  gtacaccaag gaaaagcagt tggcggttaa tttggccgct gaaagggaga
   18801  agacgagact ggctcgtaga cacccgatgc gttctccgga agaaactccg
   18851  gaattctata aattcggtat aactgctaaa gcaatgttac cgaacatcaa
   18901  cgctgtggac gttggtgata acgaggacac ttcgtcggag tacccagtga
   18951  gtctgagtgt ttctgacgga gttctccgtg aacaccactt catctgattg
   19001  aagtggacgg aataagttcc ttgcggaact ttatgtcggg ttggtaaaaa
   19051  cccttatgat ggtgatgtat cactagacaa taaccggatg ggtaaagtct
   19101  ttaaaatgat cgaggggaaa aattaaccgt atcctctcgt tggtctaagc
   19151  tcccacagag tggtagtggt ctcaagtgag gcttaacgta tgcgtgaacc
   19201  aaagaagttc tccttagagt gtgtgttgtt tacccaacac actgtcccta
   19251  tgggggccaa cataggtcca