Sequence of DPV Leishmania RNA virus 1-1

Leishmania RNA virus 1 - Lg1398 capsid protein gene, complete cds; and RNA-dependent RNA polymerase gene, partial cds.

ACC No: JX313127

Dated: 2013-02-03 | Length: 3228 | CRC: -2086143214

                
ID   JX313127; SV 1; linear; genomic RNA; STD; VRL; 3228 BP.
XX
AC   JX313127;
XX
DT   03-FEB-2013 (Rel. 115, Created)
DT   03-FEB-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Leishmania RNA virus 1 - Lg1398 capsid protein gene, complete cds; and
DE   RNA-dependent RNA polymerase gene, partial cds.
XX
KW   .
XX
OS   Leishmania RNA virus 1 - Lg1398
OC   Viruses; dsRNA viruses; Totiviridae; Leishmaniavirus;
OC   unclassified Leishmaniavirus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3228
RX   PUBMED; 23326619.
RA   Zangger H., Ronet C., Desponds C., Kuhlmann F.M., Robinson J.,
RA   Hartley M.A., Prevel F., Castiglioni P., Pratlong F., Bastien P.,
RA   Muller N., Parmentier L., Saravia N.G., Beverley S.M., Fasel N.;
RT   "Detection of leishmania RNA virus in leishmania parasites";
RL   PLoS Negl Trop Dis 7(1):E2006-E2006(2013).
XX
RN   [2]
RP   1-3228
RA   Zangger H., Desponds C., Fasel N.;
RT   ;
RL   Submitted (16-JUL-2012) to the INSDC.
RL   Biochemistry, University of Lausanne, Boveresses 155, Epalinges, VD 1066,
RL   Switzerland
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3228
FT                   /organism="Leishmania RNA virus 1 - Lg1398"
FT                   /host="Leishmania guyanensis 1398 (MHOM/BR/89/IM3597)"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="1989"
FT                   /db_xref="taxon:1285423"
FT   CDS             86. .2314
FT                   /codon_start=1
FT                   /product="capsid protein"
FT                   /protein_id="AGD88193.1"
FT                   /translation="MSDIPNSDKISCGRKPMFCEIIKLANRRRLIFDTSSERVYDARVN
FT                   YCSTADATVQADCHIYWRLKLRRADAVFEEFTGQGYSLDTAAYPQQYADIIRGYYSKHV
FT                   SSALAANTQHFVNVLAMLRHAGACIAHYCMTGKIDFDILSKKKYKNKEVITLSSADSLS
FT                   FLPHSALYLPSPLRASDPEIFNMLYLLGCACDASIAMDNISNTSGAAKYSMPHYNPLQL
FT                   SHALHVTIFYMLGLMDSCGCGEDAVLALTAGLHSVTTVIAHSDEGGITRDALRELSYTQ
FT                   PYGTMPVPITGYFQHINVLFTTQPAWDQFAGIWDYVILATAALVHLSDPGMTVNDVTYP
FT                   TTITTKVASVDGRNSDIAAQMMHSATRFCDIYIENLCTFWGVVANPEGNASQALLHAFN
FT                   IVACGAEPNRHLDLNVMAPWYWIESSALFSDYSQFRSPISSAGYGPQCVYGARLVLAAT
FT                   NTLEFTGEAGDYSAYRFEWTTMRHNPLFNILNKRAGDGLANVDFRLRPFNEWLLEGQPS
FT                   RRSCNAAGHGTPTAACCHKSPNRDSLDEYIWGSTSCDLFHPAELTSYTAVCVRFRNYLS
FT                   SADGEVHLLNTPTREVIEGNITTRCDGIRCLDSNKRIQHVPEVARRYCMMARYLAQART
FT                   FGSLTIGDDIIRGFDKVEKVVKMHKSNNRLGQMPLIDVTGLCLPMVETSTVRASTTTRI
FT                   DPNKLAAAVARTELPIAPRSTSSLIPSSDAVPEAEPQAGEPGNGSGCA"
FT   CDS             <2241. .>3228
FT                   /codon_start=1
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="translation probably initiates at the 5' end of
FT                   major capsid protein coding sequence and results in the
FT                   expression of a fusion protein via a translational
FT                   frameshift"
FT                   /protein_id="AGD88194.1"
FT                   /translation="SLLQTQCPKRNHKLVNRAMVVVALKYFEDVGYVVSGILDMSRLTS
FT                   TSIKGQHKNNSDYFYKYNLLFSQVPAIVLNQLKCCVKAQVDDAIKTTLQATGKVKISKP
FT                   VEKMLTFSVINRFLGYPDSDGSVTRYSEEQSSPIAAKLLLTFLSSVLVAMVPASVDPHI
FT                   SGNKIPRHYYTLKAHVGAQKKVNLTAIEVIRGCQHECIAVYCEFVRYSAYFADLYDDQV
FT                   ASILLYAVAAHNIQGFGARFSILWALSCVKVSALADDINIYVKHRGMSGLLPQLVEMRC
FT                   LLGRGVKEIDVEAEARRRLDASNLDMQGFKEEELRAAVKQVYAEEVRR"
XX
SQ   Sequence 3228 BP; 877 A; 675 C; 773 G; 903 T; 0 other;

jx313127 Length: 3228  03-FEB-2013  Type: N  Check: 6091  ..

       1  tcctacaacg acagcaacta tatctaccat ctacgaccta agaattccac
      51  gtgaacatac cttgagtata caattcttgg ccaagatgtc tgatataccg
     101  aactctgata agatctcgtg cggacggaaa ccaatgtttt gtgagattat
     151  aaaactcgca aacagaagga gattgatctt tgacacatcg agtgagcgtg
     201  tgtatgatgc ccgtgtgaac tactgctcca ctgctgatgc aacagttcaa
     251  gcagattgcc atatatactg gcgacttaag ctgcgccgtg ctgatgctgt
     301  ctttgaggaa ttcacaggac aggggtattc acttgatact gctgcatatc
     351  ctcaacaata tgctgatatt attcgaggct actacagcaa acatgtatca
     401  agtgctctcg ctgcaaacac tcaacacttt gtgaacgttt tggcaatgtt
     451  acgtcatgct ggtgcttgta ttgcacatta ttgcatgacc gggaaaattg
     501  attttgatat tttaagtaaa aagaaataca aaaacaagga ggtcatcacc
     551  ttgagcagcg ctgacagctt aagttttttg cctcactcgg ctttatatct
     601  gccttcccct ttacgtgcaa gcgaccctga gatatttaac atgttgtact
     651  tacttggttg cgcttgtgat gcgagtattg ctatggacaa tatctccaac
     701  actagcggtg ctgcaaagta ttcaatgcca cattacaacc cattacagtt
     751  gtcccatgcg ttgcatgtca caatcttcta tatgttgggt ttgatggaca
     801  gttgtgggtg cggtgaggat gcagttttgg ctctaactgc tgggttacac
     851  tcagtcacaa cggtcattgc gcacagtgat gaaggtggca ttactcgcga
     901  tgcattgagg gaactgtcgt acacacagcc gtatggcacg atgccagtgc
     951  ctataactgg ctattttcag cacattaatg tgctatttac aacccaaccg
    1001  gcttgggacc aatttgctgg gatatgggat tacgtgatcc tcgctactgc
    1051  agccctggtt catttatctg atccagggat gactgtaaac gatgtaacat
    1101  accccacaac cataactaca aaggtagcgt cggttgatgg gagaaatagc
    1151  gatatcgcag cccaaatgat gcacagtgct acgcggtttt gtgatatcta
    1201  catcgagaac ttgtgtactt tttggggcgt tgttgcaaac cccgagggga
    1251  atgcaagcca ggctctacta catgctttta acatcgtcgc gtgtggtgct
    1301  gaacctaaca gacatctcga cttgaatgtg atggcaccgt ggtattggat
    1351  tgaaagttct gctttattca gtgactactc acagttccgt tcaccgatat
    1401  cttcagcagg ctatggtcca caatgcgtgt atggtgcacg actagtactg
    1451  gcggcgacga acacgctgga gtttacaggt gaagcgggtg actactcggc
    1501  ctaccgattt gagtggacta ctatgcggca taacccgctc tttaacatac
    1551  tcaataaacg ggctggtgat ggcctcgcaa atgttgattt taggctgcga
    1601  ccattcaatg agtggctact tgaggggcag ccgagtcgcc gaagttgcaa
    1651  tgctgcaggc cacgggacac caacagcagc ctgttgtcat aaatccccca
    1701  atcgtgattc tctggatgaa tatatatggg gtagtacatc atgtgattta
    1751  ttccacccgg ctgaactaac ttcatatact gctgtctgtg ttagattcag
    1801  aaactacctt tcgagtgcgg acggtgaagt ccacctatta aacacgccga
    1851  caagggaagt tattgaaggc aacattacaa ctaggtgtga cggtatacgt
    1901  tgtcttgaca gtaataagcg catacaacat gttccagagg ttgcgcgccg
    1951  ctattgcatg atggcgaggt atctggcgca agcacgtact ttcggctcgc
    2001  ttacgatagg cgatgatata attcgtggtt ttgacaaagt tgaaaaagtg
    2051  gtcaaaatgc ataagagtaa taatagatta ggtcaaatgc ccttgattga
    2101  cgtaactggt ctttgtttgc ctatggtcga aacgagtact gttcgtgctt
    2151  ccacgactac tcgtatagac ccaaacaaac ttgctgcagc tgtggcccgc
    2201  actgaattac cgatagcgcc acgttctacg tcctccctga tcccttcttc
    2251  agacgcagtg cccgaagcgg aaccacaagc tggtgaaccg ggcaatggta
    2301  gtggttgcgc ttaagtattt tgaggatgta gggtatgtgg ttagcgggat
    2351  ccttgacatg tcacggctga caagtacgtc aattaaaggg caacataaga
    2401  ataattcaga ttacttttat aaatataatc tattgttttc ccaagtgcca
    2451  gcgatcgttc taaatcaact taagtgttgt gtaaaggctc aagttgatga
    2501  tgccatcaaa acaactcttc aggcaactgg taaggttaag ataagtaagc
    2551  cagttgaaaa aatgcttaca ttctcagtta taaacagatt ccttggttac
    2601  cctgattctg atggatctgt tactcggtat tcggaggaac aatcgagtcc
    2651  tattgctgca aaactacttt taacgttcct ttcttctgtt ttggttgcaa
    2701  tggtaccagc aagcgttgat ccacatataa gtgggaataa gatcccacgc
    2751  cattactata ctctcaaagc acatgtaggt gctcaaaaga aagtgaacct
    2801  gacagccatt gaggtgataa gaggttgtca acatgaatgt attgctgttt
    2851  attgtgagtt tgtacgatat agtgcttatt ttgcggattt gtatgatgat
    2901  caggttgcca gtatcctact atatgctgtt gccgcacata atatccaggg
    2951  attcggtgca cgcttcagca ttctgtgggc actgtcatgt gtaaaagtaa
    3001  gcgctttggc tgatgatata aatatatatg taaaacacag aggaatgtca
    3051  gggttgttgc cacaattggt tgaaatgagg tgtttgctgg gaaggggagt
    3101  aaaagagata gacgttgaag ctgaggcaag gcgcagatta gatgcgagca
    3151  atcttgatat gcaggggttc aaagaagagg aactacgtgc tgcagttaag
    3201  caggtctatg cagaagaggt acgcagat