Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 12C p20 protein gene, complete cds.

ACC No: JX402742

Dated: 2012-10-05 | Length: 549 | CRC: -263071769

                
ID   JX402742; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   JX402742;
XX
DT   01-OCT-2012 (Rel. 114, Created)
DT   05-OCT-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 12C p20 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Ferretti L., Fontana A., Sciarroni R., Schimio R., Loconsole G.,
RA   Albanese G., Saponari M.;
RT   "Molecular and biological evidence for a severe seedling yellows strain of
RT   Citrus tristeza virus spreading in Calabria (southern Italy)";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Ferretti L., Fontana A., Sciarroni R., Schimio R., Loconsole G.,
RA   Albanese G., Saponari M.;
RT   ;
RL   Submitted (19-JUL-2012) to the INSDC.
RL   CRA-PAV Plant Pathology Research Center, Via C. G. Bertero 22, Rome, Rome
RL   00156, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="12C"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /isolation_source="Citrus sinensis"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /protein_id="AFS63689.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEIGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 134 A; 110 C; 141 G; 164 T; 0 other;

jx402742 Length: 549  05-OCT-2012  Type: N  Check: 5819  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  tggttcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcgg acatgaacgg cgatcatcag gatggtcacc atgagatagg
     201  tgaacataaa tctcggttgt tgtgcaatat agaggcgaaa ctgcgagtgc
     251  ttctcgacat cataagacgt cggtttactc gcgaaaaact gctctgtacc
     301  agtgctacag atgttgtggg cttcttcgtc gtgaggtaca tgagttctag
     351  tcacactagt ttcgaaaccg taatgcgaac ggaactgaag ttggtggtta
     401  aagctgtgct gtcggaattg tcccgcacgc ataaactaga ttttagcgag
     451  cgagccttta cggcttacgg tatccttttg cagaagggca ccgtggcaac
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag