Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 14B p20 protein gene, complete cds.

ACC No: JX402744

Dated: 2012-10-05 | Length: 549 | CRC: 675413297

                
ID   JX402744; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   JX402744;
XX
DT   01-OCT-2012 (Rel. 114, Created)
DT   05-OCT-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate 14B p20 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Ferretti L., Fontana A., Sciarroni R., Schimio R., Loconsole G.,
RA   Albanese G., Saponari M.;
RT   "Molecular and biological evidence for a severe seedling yellows strain of
RT   Citrus tristeza virus spreading in Calabria (southern Italy)";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Ferretti L., Fontana A., Sciarroni R., Schimio R., Loconsole G.,
RA   Albanese G., Saponari M.;
RT   ;
RL   Submitted (19-JUL-2012) to the INSDC.
RL   CRA-PAV Plant Pathology Research Center, Via C. G. Bertero 22, Rome, Rome
RL   00156, Italy
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="14B"
FT                   /mol_type="genomic RNA"
FT                   /country="Italy"
FT                   /isolation_source="Citrus sinensis"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /protein_id="AFS63691.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHRSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYTASSHISFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 142 A; 113 C; 133 G; 161 T; 0 other;

jx402744 Length: 549  05-OCT-2012  Type: N  Check: 2727  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt agtacactct
     151  atgaagtcag acatgaacgg tgatcatcaa gatggtcacc atgagatggg
     201  tgagcacaga tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag acgtgatggg cttcttcgtt atgaggtaca cggcttctag
     351  tcacatcagt ttcgaatccg taatgcgaac ggagctgaaa ttagtagtta
     401  aagcagtact atcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatcctttta caaaaaggta ctgtagcgac
     501  cgtttgtggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag