Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate GLV2 1050-02 polyprotein (ORF1a), RNA-dependent RNA polymerase (ORF1b), 6.3 kDa small hydrophobic protein (ORF2), putative heat shock protein 70 (ORF3), 63 kDa putative cell-to-cell movemennt protein (ORF4), minor capsid protein (CPm), major capsid protein (CP), 19 kDa protein (ORF7), and 24 kDa protein (ORF8) genes, complete cds.

ACC No: JX513891

Dated: 2012-10-28 | Length: 16489 | CRC: -658245963

                
ID   JX513891; SV 1; linear; genomic RNA; STD; VRL; 16489 BP.
XX
AC   JX513891;
XX
DT   28-OCT-2012 (Rel. 114, Created)
DT   28-OCT-2012 (Rel. 114, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate GLV2 1050-02 polyprotein
DE   (ORF1a), RNA-dependent RNA polymerase (ORF1b), 6.3 kDa small hydrophobic
DE   protein (ORF2), putative heat shock protein 70 (ORF3), 63 kDa putative
DE   cell-to-cell movemennt protein (ORF4), minor capsid protein (CPm), major
DE   capsid protein (CP), 19 kDa protein (ORF7), and 24 kDa protein (ORF8)
DE   genes, complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16489
RA   Rott M.E., Belton M., Saeed H.;
RT   "Detection of grapevine and tree fruit viruses by next generation
RT   sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-16489
RA   Rott M.E., Belton M.;
RT   ;
RL   Submitted (21-AUG-2012) to the INSDC.
RL   Centre for Plant Health, Canadian Food Inspection Agency, Sidney
RL   Laboratory, 8801 East Saanich Rd, North Sanich, British Columbia V8L 1H3,
RL   Canada
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLCBio Genomic Workbench v. 4.5
CC   Sequencing Technology :: Illumina
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16489
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="Vitis vinifera"
FT                   /isolate="GLV2 1050-02"
FT                   /mol_type="genomic RNA"
FT                   /country="Canada"
FT                   /collection_date="Sep-2010"
FT                   /db_xref="taxon:64003"
FT   gene            95. .8890
FT                   /gene="ORF1a"
FT   CDS             95. .8890
FT                   /codon_start=1
FT                   /gene="ORF1a"
FT                   /product="polyprotein"
FT                   /note="contains conserved domains for RNA methytransferase,
FT                   two papain-like endopeptidases and a viral RNA helicase"
FT                   /protein_id="AFV34733.1"
FT                   /translation="MSSLAISALPSAVAQLSFGQPAATVAKSFYMTSLPSLQTCFTQCE
FT                   FSSLFICLASFQKIKTFLSFLSSVRELALFSELSTIGFCCEFIRLGVGEHPLFFVSFQC
FT                   GPLSVCLGCVNGIFAVLNISFPFLDVASLLMDVGDVVAPTKVRISKREKKLNKRAFSIA
FT                   RAAARIRRSKVGNKEVRISHVQPLPAGCLRFSQNKNRSELIIIGRDVGVVARVKTAAPV
FT                   VRRRGSGGLVPLIPLVAVSPFGVRYRCYAPSCGAIACFKNKLASRVAANDSRAEKLLSA
FT                   RRRKLQQQNFNSRVAKKARDVTASRVDIAEGEVTPPRHIFFGSFSEPFPIPSSSGMARS
FT                   VLREEPAIVTCGASAPAIKETPRVSVKKADFSPAAPVPREALTPRVAKRGEAIVISGVV
FT                   HEVLNKIREGVLRFRVGGDMRFSRFFSSTHGCKIVANVRTNTSVWLNCTKVNGEKFSVA
FT                   IPCSVDYVAMLRYVSGGKFPLVLMSRECYPDGLCYMAHMRYLCAFFCQPFRESDYPLGS
FT                   WPSVARLKALVLKRFGDEALNIGVRGYYVSRRAFHCDYDSKYARSLMRLVGHVGGDEVI
FT                   HSTLASTVVLKPGERARDRPKSISFGSFCCELRYVESVNPDAPRLRSEKVLRKVEPRNG
FT                   VRTESADVGSNVTRKRDARIDRKFSHLLAGSVNKVKKRIAAGVLRYRVGGDMDFHNSFL
FT                   TQAGYHLLVRRKTSSSVCVELSTPDGRLLRRDVIPCSRDYAAMLSFAAGGRFPLVLMTR
FT                   DKYKNGYCYLAHCRYASAFLLKGFHPAVFDIGANPTAAKLRSRMVSVLGDRSLSLNLYG
FT                   SFTSRGIFHCDYDAAYVKDLRFMSAIVAGKEEMGEVVASDITPAMKQKTIEAVYDRLYG
FT                   GNDSLLKLSIEKDLIDFKNDVQSLKKDRPVIRVPFYMSEVTQNSLTRFYPQFELKFSHS
FT                   THSDHPAAAASRLLENETLVRLCGHSVSDIGGCPLFHLNSKTQRRVHVCRPVLDGKDAQ
FT                   RRVVRELQYSSVRSGDDEKILEGPSNVDVCHYPLGVCEHESSTMMMVQVYDASLYEICS
FT                   AMIKKKARVTYLTMVTPGEFLDGRECVYMESLDCDIEVDVHADVVMYKFGSSCYSHKLS
FT                   IIKDIMTTPYLVLGGFLFSVEMYEIRMGVNYFKITKSEVCPNISCSKLLRYRRANSDVV
FT                   KVKLPRFDKKRRMCLPGYDIIYLDSKFVSRVFDYVVCNCSAVNSKTFEWVWSFIKSSKS
FT                   RVIISGKIIHKDVNLDLKYVESFAAVMLASGVRSRLASEYLAKNLSHFSGDCSFIEATS
FT                   FVLREKIRNMTLNFNECLLQLVKRVAFATLDVSFLDLDATMESITDFAECKVAVELEEL
FT                   GCLRANAENEKIRNLAGDSMAAKLASEIVVDIDAKPVAKHAEHPKSEVSEKKEHAKPGL
FT                   RGGSKAGVLKEFLGFVLSSASRLFSCVADQQRIKSYVHYLDTAVSFLDQNYENLSFIMR
FT                   VLSKGYSCMFSYLANRGSLANRVASAVQIVREIAVLCANVSVSKAKVVITFSAAVCAMM
FT                   FNSCGFSGDGREYKSYMHRYTQVLFDTIFFEDSSYLPIELLSSAICGAIVTLFSSGTSV
FT                   SLNAFLLQITKSFSLELIVRNVVRVTHSLSTTATDGVMRSVFSQIISHLLVGNTGNLAY
FT                   QIAFLTGVVPLLVKKCVGLIFSMSEDTYSGFIKHGVSEFSFITNILKYLRGQLVDELKA
FT                   VVQGVFDSNKHLFRDVTQEAIRSTVMQIPTAVVDGLKCAASKVYSGIVGKKTNVGEEKS
FT                   RGGGDDYEEYFSCDESETPGLRGGSRSGFSILFFFSRLVRRARILIGRIKHRCFSKIFE
FT                   SISLKIHELRTFLLGKKRSDVGVYEFLSEDVADALSSINECDEIENLIGDGFRDMADDS
FT                   PTDTNYFDFSDEFLASVNGLPCAGLRGGGRRVGMLAILNYVYNSLSIVARAASKNSTFT
FT                   SLIIFSRGLVDRIRNIFSNKESVVELVRKYVKNFLKSRMRGLGLRNEHVVNSFGELVPL
FT                   LLRNKLSETFIYRAVPMSKWCWEVCLSAERREKFFALVCLVTLGFPYFARLLGGVVCDK
FT                   LLSSLRRAYDRVIVFLKERCDAAMNGLRCLFHFDGNGDSTSAGLKGGGSQTFLWGLLLR
FT                   LVRFALSLGYAGCKCVFSHHNLFFLCVSLVEEVNMIAKILGGLSFFSRPISSALAFVLL
FT                   QPERFVEYSGKLSTTFLFFLKISPRVPLKIKGFFEWVAGNPLLRGVRRFLRLIAVKLNL
FT                   RRKRGLRTRNGGYPSQRAVPVIPSNRVTNDGCERLSEKMQGVEALRSELRILEELDAAV
FT                   VEKLNKRRNREADDSEFSRPMHESTHDVTSFCSKANSVGTALERAVLVEDAVKSEKISR
FT                   MAKDLVRKGTVSDEEITNTLSDDEAIEEVPVSEERDDSPKTVRVSEYLNRLNSSFEFPK
FT                   PIVVDDNKETGGLTNAVREFYYMQELALFEIHSKLCAYYDQLRIVNFERSMAPCNEDAQ
FT                   LYVRKNGSTIVQGKDVRSNIKDFHDHDFLFDGKISVNRRRRSGNVLYHDNLSFLASNLF
FT                   LAGYPFSRSFVFTNSSVDILLYEAPPGGGKTTTLIDSFLKVFKKGEVSTMILTANKSSQ
FT                   VEILKKVEKDISNIECQKRKDKRTPKKSIYTIDAYLMHHRGCDADILFIDECFMVHAGS
FT                   VLACIEFTRCHKVMIFGDSRQIHYIERNELDKCLYGDLDRFVDLQCRVYGNVSYRCPWD
FT                   VCAWLSVVYDNMIATVKGESEGKSSMRINEINSVDDLVPDMGSTYLCMLQSEKLEISKH
FT                   FIRKGLSKLNVLTVHEAQGETYARVNLVRLKFQEDEPFKSIRHITVALSRHTDSLTYNV
FT                   LAARRGDATCDAIQKANELVNKFRVFPTSFGGSVINLDVKKDVEDNSRCKASSAPLSVI
FT                   NDFLSDVNPGTTVIDFGDLSADFSTGPFECGASGIVVRDNISSSNITDHDKQRV"
FT   gene            8766. .10268
FT                   /gene="ORF1b"
FT   CDS             8766. .10268
FT                   /codon_start=1
FT                   /gene="ORF1b"
FT                   /product="RNA-dependent RNA polymerase"
FT                   /protein_id="AFV34734.1"
FT                   /translation="MISEISLQILARDLSSVALAASSCETTSPPATSLITISSVFSAVR
FT                   SQAIPRRKPSLQENLYSFEARNYNFSTCDRFTSASMFGEAMAMNCIRRCFDLETFSSLR
FT                   DDVISITRSGIEQWLEKRTPSQIKALMKDIESPLEIDDEICRFKLMVKRDAKVKLDSSC
FT                   LTKHSAAQNIMFHRKSINAIFSPIFNEVKNRIMSCLKPNIKFFTEMTNRDFASVVSNML
FT                   GDDDVYHIGEVDFSKYDKSQDAFVKSFEEVMYKELGVDEELLAIWMCGERLSIANTLDG
FT                   QLSFTIENQRKSGASNTWIGNSLVTLGILSLYYDVRHFEALYVSGDDSLIFSRNKISNY
FT                   ADDICADMGFETKFMSPSVPYFCSKFVVMCGHKTFFVPDPYKLFVKLGAVKEDVSMDFL
FT                   FETFTSFKDLTSDFNDERVIQKLAELVALKYDVQSGNTTLALSVIHCLRSNFLSFSKLY
FT                   PRVKGWQVFYTSVKKALFKSGCSLYESYVTPFGHAVMVWDDE"
FT   gene            10361. .10531
FT                   /gene="ORF2"
FT   CDS             10361. .10531
FT                   /codon_start=1
FT                   /gene="ORF2"
FT                   /product="6.3 kDa small hydrophobic protein"
FT                   /protein_id="AFV34735.1"
FT                   /translation="MDQVLQFECLYLLNQAVFAITFVFILLIIRVIKSFRRNVHETPIS
FT                   AVRGQGFSTVV"
FT   gene            10540. .12339
FT                   /gene="ORF3"
FT   CDS             10540. .12339
FT                   /codon_start=1
FT                   /gene="ORF3"
FT                   /product="putative heat shock protein 70"
FT                   /note="HSP70h"
FT                   /protein_id="AFV34736.1"
FT                   /translation="MVVFGLDFGTTFSTVCVYKDGKVYSFKQNNSAYIPTYLYLFSETN
FT                   HMVFGYEAESLMHNAKVRGSFFRDLKRWVGCDSSNFSDYFDRLKPHYAVRPYKIGTGLN
FT                   DTVIIGNYGGTVRSEVHLPGLIASFIKAMVSCAENAFSCTCTGVICSVPANYDSVQRNF
FT                   TDQCVSLSGYQCVYMVNEPSAAALSACNLINKKSANLAVYDFGGGTFDVSIISYRNNTF
FT                   VVRASGGDLNLGGRDVDRAFLTHLFSLTSLEPDLSLDISNLKESLSKTDAEIVYTLKGS
FT                   DDKREDVRVNKSILTTVMLPYVNRTLNILEATLKSYAKNMGGLRSVKCDLVLIGGSSYL
FT                   PGLEDILSKHRRIDRILKVADPRAAVAVGCALYSSCLSGSQGLLLVDCAAHTIAIAGMS
FT                   CDQIICAPAGAPIPFSGTTPLYLPKANRNSQRQIAVFEGEYVKCPRNRKICGSNIKFLD
FT                   IGVTSVSHSPITFYLDVAISSVGAISFVVRGPEGKEVSLTGTPAYNFSSVVLGTRSVRE
FT                   LHISLSNKVHLGLLLHRKADRRLLFSEGEAVRYVETVEVADVLKEFKSYNASSLPPDED
FT                   VEPLMGKSVQKVLRGGRLEEIPL"
FT   gene            12266. .13870
FT                   /gene="ORF4"
FT   CDS             12266. .13870
FT                   /codon_start=1
FT                   /gene="ORF4"
FT                   /product="63 kDa putative cell-to-cell movemennt protein"
FT                   /note="similar to viral heat shock protein Hsp90"
FT                   /protein_id="AFV34737.1"
FT                   /translation="MSNHSWGSLFKKYYGEADWRKYLSKSIVAHTANIKTLPDVQLYGG
FT                   RTVKKSEFESVTPRSFEQELGLLMLSERDVGWCKMCGITVEEAMYQITNPEAYPITAEK
FT                   CDPDVKTEGQKYTMEDVMNFMRRSNLDINDKILAEQCWSLSNSCGVLINPDDKERFVAL
FT                   TFKNNELVNDSSNANIDCRVGDYLVYAMSLFNCRSQKSQAGNISLYEKYCAYIRTYLEN
FT                   TDLYFTSPDRIPLLTGILYDFCKEYNIFYSTYKRNVDNFRFFLTNYMPLISDIFVFQWV
FT                   KPAPDVRLLFDISAAELTLEVPTLSLVDSQVVIGHVLRFVESYTADPAIDALEEKLDAI
FT                   MKKSNPHLSTAQLWVGFFCYYGEFRTAQRRVVQRPGVYKTPNSVGGFEINMKNVEEFFD
FT                   KIQREVPNVSLRRQFNGARAHEAFKVFKKGNISFKPISRLNIPREFWYLNVDYFRHANR
FT                   SGLSEEEVLILNNISVDVRKLCAERACSTLPSAKRFSKGHKSSVPSLRQEKNYRDPLIT
FT                   LRNSLYEFRHGNRDRRV"
FT   gene            13833. .14504
FT                   /gene="CPm"
FT   CDS             13833. .14504
FT                   /codon_start=1
FT                   /gene="CPm"
FT                   /product="minor capsid protein"
FT                   /protein_id="AFV34738.1"
FT                   /translation="MSSGTGIAIGGSEAIETSGFVLSTRKEAVDKFFNELRNENYSSVD
FT                   SSRLSDQEVKEVLEKSKESFKSELASTDEHFVYHIIFFLIRCAIISTSDKVKYVGSHKY
FT                   VVEGKTYTVQDVWVFNMIKGLTKQYKRVNGLRAFCCACEDLYLTVAPAMSERFKTKAIG
FT                   MKGLPVGKEYLGADFLSGTSRLMSDHDRAVSIVAAKNAVDRSAFTGGERKIVSLYDLGR
FT                   N"
FT   gene            14592. .15188
FT                   /gene="CP"
FT   CDS             14592. .15188
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="major capsid protein"
FT                   /protein_id="AFV34739.1"
FT                   /translation="MELMSDDNLSGLVITDASSLNGADKKLLSAEVIKMLVQKGAPSEG
FT                   IEIVFGLLLYALAARTTSPKVQRADSDIIFQNTYGDKTVVVTEGDLKKVLEGCAPLNRF
FT                   TNKPRTFGRTFTEAYIDFCVAYKHKMPQLNAAANLGIPAEDSYLAADFLGACPKLSELQ
FT                   QSRKMFASMYALKTEDGVVNTPVSNLRQLGRREVI"
FT   gene            15185. .15673
FT                   /gene="ORF7"
FT   CDS             15185. .15673
FT                   /codon_start=1
FT                   /gene="ORF7"
FT                   /product="19 kDa protein"
FT                   /protein_id="AFV34740.1"
FT                   /translation="MMEICAQNPEALVLLRTNQNTTLLVVKSDDEVNLPKLLICGYLRV
FT                   SHRGDVTGCNREDIIKDFEGAHHTVIRSRTVQYDYESAVKEYNNADCVVKFFLETGDVF
FT                   WFFLQSDIKGRAARHLRTFFEANNFFFGSHCGTMEYCLKQVLIETESVIESFCEERNR"
FT   gene            15675. .16292
FT                   /gene="ORF8"
FT   CDS             15675. .16292
FT                   /codon_start=1
FT                   /gene="ORF8"
FT                   /product="24 kDa protein"
FT                   /protein_id="AFV34741.1"
FT                   /translation="MRVIVSPYEAEDILTRSTEMLRNIDSGALDTKECIEAFSTLTRDL
FT                   HCAKASYQWCVDTGLCRRDCAEKRLIDTVESNLRLAQPLIREKVATHFCKDEPKELVAF
FT                   ITRKYVKLTGVAAREAVKIEMRTLSKTVLNKLSLEMAFYISPRAWKNAEWLDLRYTPLK
FT                   IYRDLLLDVDTLNALCEEDEVHVVVTNKDEDENHDLELQEDC"
XX
SQ   Sequence 16489 BP; 4236 A; 3422 C; 4213 G; 4618 T; 0 other;

jx513891 Length: 16489  28-OCT-2012  Type: N  Check: 7333  ..

       1  ctttcacctg tgtttgtgcc tcggttcaac cacaacctga aagtttcagt
      51  tcccaggagt atcggttttt cctcagaaac cttacttctt cagaatgtct
     101  agccttgcta tttctgctct tccctccgcg gttgctcaat tgagttttgg
     151  tcagcctgct gccacggttg ccaagtcatt ttacatgact tcccttccgt
     201  cccttcagac ttgcttcact cagtgcgagt tttcctctct ttttatttgt
     251  ttggcttctt tccaaaaaat aaaaacattt ctttctttcc taagttcagt
     301  gcgtgaactc gctctttttt ctgaactgtc cacgattgga ttctgctgtg
     351  aattcattcg cttaggtgtt ggagaacatc ctttgttttt tgtttccttc
     401  cagtgcggac ctttgtccgt gtgtttgggg tgtgtgaatg gtatttttgc
     451  cgttctcaac atttcttttc cctttctcga cgttgcttcg ttgttgatgg
     501  acgttggtga tgtggtcgct ccgaccaagg taagaatttc caaacgagag
     551  aagaagttga ataagcgcgc tttttcaata gctcgtgctg ctgcgcgtat
     601  taggcgttcc aaggttggaa ataaggaggt tcgcatctct catgtgcagc
     651  ccctccctgc tggttgctta cggttttccc aaaacaaaaa cagatcagaa
     701  ctcatcataa taggtcggga cgtaggtgtt gtggcgcgcg taaaaaccgc
     751  agcacctgtt gtgcggcgtc gcggtagcgg cggtcttgtt cccctcatac
     801  ccctagtagc cgtttcgcct tttggggtga ggtaccgttg ttacgcgcct
     851  tcatgtggcg cgatcgcgtg tttcaagaat aagctcgcta gccgtgttgc
     901  cgctaacgat agtcgcgccg agaagcttct ttcagctcgg cgccgtaaat
     951  tgcagcaaca aaatttcaac agtcgtgtgg cgaagaaagc gcgtgacgta
    1001  actgcgtcgc gcgtcgatat agcagaaggt gaagtcacac caccgcgcca
    1051  catctttttt ggtagttttt cggaaccctt tccaatacct tcttcttccg
    1101  gaatggcgag atcggtgctt cgtgaagaac ccgctatcgt tacgtgtggc
    1151  gctagcgcgc ccgcgataaa agaaactccg cgggtgagtg tgaaaaaggc
    1201  ggatttttca ccggcggcgc ctgttccgcg ggaggctctt accccaagag
    1251  tcgctaaacg cggtgaagcg atcgtcatat cgggcgtggt gcacgaagtt
    1301  ttgaataaga ttagagaggg cgttttgcgc tttcgcgtgg gcggtgatat
    1351  gcgtttctct aggttcttct catcaaccca cggttgcaaa attgttgcca
    1401  acgtgcgcac caacacttcc gtgtggttga actgcactaa ggtcaatggt
    1451  gaaaaatttt cggtggcgat cccttgttcg gtggattatg tagcgatgct
    1501  gcgttacgtg agtggcggga agttcccgct tgtcctgatg agcagggaat
    1551  gttaccctga tgggctatgt tacatggctc acatgaggta tctgtgtgct
    1601  ttcttttgcc aacctttcag agaatcagac tatcctctgg gttcgtggcc
    1651  atcggtggcg cgattgaagg cgttggtttt gaagcgcttt ggtgacgagg
    1701  cgctgaatat aggcgttcgc ggctactatg tctctcgtag ggcttttcat
    1751  tgcgactacg attctaaata cgcgagaagc ttgatgaggc ttgtggggca
    1801  tgtcggggga gacgaggtta tacattcaac gttggcgtcc acggtcgtgt
    1851  taaaaccggg tgaacgcgca cgcgatcgtc cgaaaagcat aagttttgga
    1901  tcgttttgct gcgagttgcg ttacgtcgag tccgtcaatc ctgacgcccc
    1951  tcgcttgcga agtgagaagg ttctgaggaa agtggagccg cgcaatgggg
    2001  ttcgcacgga aagcgctgac gttggttcga acgtcacacg gaagcgcgac
    2051  gcccgcatcg atagaaagtt ttcgcatctt ttagcgggaa gcgttaataa
    2101  agtgaagaaa cgaatcgcgg ccggggtgtt gcgatatcga gtcggcggtg
    2151  acatggactt tcataactcc tttcttaccc aagcgggcta ccacttgcta
    2201  gtgcggcgta agacgagcag cagtgtttgc gtggaacttt cgacgccgga
    2251  cggtaggctc ttgcgccgcg acgtcatacc ctgctcaaga gattacgctg
    2301  cgatgttgtc gtttgccgca ggaggtcgtt tcccgttggt tttaatgacg
    2351  agggataaat acaagaacgg ttattgttac ttggctcact gtaggtacgc
    2401  gagcgctttt cttctgaagg gttttcatcc tgcggttttt gacattggcg
    2451  ctaacccgac ggcggcgaag cttagatcgc gcatggtttc ggtcctaggg
    2501  gacagaagtc tgagtttgaa tttatacggg tctttcacgt cccgcggtat
    2551  ttttcactgt gattacgacg cggcttatgt gaaagattta agattcatgt
    2601  cagcgatcgt ggctggtaag gaggaaatgg gagaggtggt tgcttctgat
    2651  ataactccgg cgatgaaaca gaagactatc gaagctgttt acgataggtt
    2701  gtatggtggt aacgattcgt tgttgaaatt gagcatagag aaagatctaa
    2751  tagatttcaa gaatgacgtt cagagcctga agaaggatag acccgttatt
    2801  agggtgcctt tctacatgtc tgaagtcact cagaactcgc tgacgcgttt
    2851  ctatcctcaa ttcgagctta aattctcaca ctctacgcac tctgatcatc
    2901  ccgcggcggc cgcttcgagg ctgctagaga acgaaacgtt agtgcgattg
    2951  tgcggtcaca gtgtttcgga cattgggggt tgtcctctct tccatcttaa
    3001  ctcaaaaacg caaaggcgcg ttcacgtgtg ccgacccgtg ttagacggta
    3051  aagacgcgca gcgtcgagtg gtgcgcgaat tgcagtattc ttcagtacga
    3101  tcgggagatg atgagaaaat tttggaaggg ccctccaatg tggacgtgtg
    3151  tcactaccct ctcggcgttt gtgagcacga gagtagtacc atgatgatgg
    3201  tgcaggttta cgatgcatcg ctctatgaga tatgcagtgc tatgattaag
    3251  aagaaggcgc gcgtaactta cctcactatg gtcactcctg gcgagtttct
    3301  cgacgggcgt gaatgtgttt acatggaatc gctagactgc gatattgagg
    3351  ttgatgtgca tgcggatgtt gtgatgtata agttcggtag ttcgtgctat
    3401  tcgcataagt tatcgatcat taaagatatt atgaccacgc cgtatcttgt
    3451  gctcgggggc tttttattta gtgtggaaat gtacgaaatc cgaatgggcg
    3501  tgaactactt caagatcacg aagtcggaag tgtgccccaa tatctcatgt
    3551  tctaagctgc tgagataccg cagggctaac agcgacgtcg tgaaagtgaa
    3601  actgccgcgt tttgataaga agcgtcgcat gtgtttaccc gggtacgata
    3651  ttatatactt agattcaaaa tttgtgagtc gtgttttcga ctacgtagtg
    3701  tgtaattgtt ccgcggtgaa ctcaaagact ttcgaatggg tctggagttt
    3751  cattaagtcc agcaaatcga gagtgattat tagtgggaag atcattcata
    3801  aagatgtcaa ccttgatctc aagtacgtcg agagtttcgc tgccgtgatg
    3851  cttgcgtcgg gtgtgcgcag caggttggct tcggagtatc tcgcgaagaa
    3901  tctcagtcat ttttcgggag attgctcctt tatcgaagcg acctcttttg
    3951  ttctgcgtga gaagattaga aatatgaccc ttaacttcaa tgaatgtctt
    4001  ctgcagttgg tgaaacgcgt ggcatttgcg actttagacg taagtttctt
    4051  agatctggat gccactatgg aatcaatcac agacttcgcc gaatgcaaag
    4101  tagctgtgga acttgaagag ttgggatgtt tgagagcgaa tgccgagaat
    4151  gagaaaattc ggaacctcgc tggcgactca atggcagcga aattggctag
    4201  cgagatagtg gtcgacatag acgcgaaacc tgtcgctaaa cacgcagaac
    4251  acccgaagag tgaagtgagt gaaaagaagg agcacgcgaa acccggcttg
    4301  cgtggaggct cgaaagccgg agttttgaaa gagttcctcg gtttcgttct
    4351  ttcgtccgcg tcgcgcttgt tcagttgcgt ggcggatcaa caacgaatta
    4401  agtcgtacgt ccattacctt gacaccgctg tatcgttctt agatcagaat
    4451  tacgaaaacc tctccttcat tatgcgcgtt ctatcgaaag gttactcttg
    4501  catgttttca tatctcgcga atcgtggtag tcttgccaat cgcgtggcga
    4551  gcgcggtgca aatcgttaga gaaattgctg tgttatgcgc taacgtaagc
    4601  gtttccaagg ccaaagtagt gatcactttt tccgcagcgg tgtgcgcgat
    4651  gatgttcaac agttgcggct tttcaggcga cggtcgagaa tataaatcat
    4701  acatgcaccg ttacacgcaa gtgttgttcg acaccatttt ctttgaagat
    4751  agtagctatc ttcccataga gttactcagt tccgcaatat gcggcgctat
    4801  cgtcactctt ttctcgtcag gaacttctgt aagtctgaat gctttcctgc
    4851  tccaaattac taagagcttc tctttggagc ttatcgtccg gaacgtggtg
    4901  cgcgtgacgc attctttgag caccacggcg actgatggag tgatgcgcag
    4951  cgtcttctct caaataatca gtcacctgct tgtgggaaac actggtaact
    5001  tagcttatca aatagctttt ttaaccgggg tggtgccctt gttagtgaag
    5051  aaatgcgtgg gtttgatttt ttcgatgagc gaggacacat actctggctt
    5101  tatcaagcat ggggttagtg aattttcgtt catcactaat atcttaaaat
    5151  acctgagagg acagctggta gacgaattga aagcggtagt tcaaggagtt
    5201  tttgactcga ataaacatct ctttcgtgat gttactcagg aggcgatccg
    5251  gtcgaccgtt atgcagatac caaccgccgt ggtggatggt ttgaaatgtg
    5301  cggctagtaa agtgtatagc ggaatagtcg gtaaaaagac gaatgttggg
    5351  gaagaaaaat cccgtggcgg tggagacgac tacgaagagt atttttcctg
    5401  cgacgagagc gaaactccgg gtttaagggg cggatccaga agcggtttct
    5451  ccatcctatt tttcttttca aggttagtgc ggcgagcgcg cattttgatt
    5501  ggcagaataa agcataggtg cttctcgaaa atttttgaga gtatctcgtt
    5551  gaagattcat gagcttagaa cctttctcct tggaaagaag cgaagcgacg
    5601  taggggtgta cgaattccta tccgaggacg tagctgatgc tctatcctcg
    5651  ataaatgaat gtgacgaaat cgaaaatctg atcggagacg ggtttcgcga
    5701  tatggcggat gactctccca cggacacgaa ctacttcgac ttctcagacg
    5751  aatttttagc ctccgttaat ggcttacctt gcgctgggtt gcgcggaggc
    5801  ggtaggaggg tgggaatgct cgccattctg aattacgttt ataactctct
    5851  aagcatcgtg gctagagcag cttcgaaaaa ttcgactttc acatctctaa
    5901  tcattttttc gcgcggattg gttgatagaa tccgcaacat tttttcaaat
    5951  aaggaaagtg tcgttgagct tgtgcgcaag tacgttaaaa actttttaaa
    6001  aagtcgcatg cgcggtttgg gtctaagaaa cgaacatgta gtgaattcgt
    6051  tcggggagtt ggtgccactg ctcttacgaa acaagttgtc tgaaactttc
    6101  atctatcgtg cggtccccat gtcgaagtgg tgctgggaag tgtgcttgtc
    6151  agctgagcgg cgggaaaagt ttttcgcgct cgtgtgctta gtcactctgg
    6201  gatttcccta cttcgctcgt cttttgggtg gggtagtgtg cgataagctc
    6251  ttgtcttcat tacgacgtgc gtacgaccgt gtgatagttt ttctaaagga
    6301  gcgatgtgac gcagccatga atgggttgcg ttgtttattt cattttgacg
    6351  ggaatggtga ttccacatct gccggtttaa agggcggtgg ctcgcaaacg
    6401  tttctatggg gcttgttatt acgtttagtg cgttttgcgc tatctttggg
    6451  ctacgcgggt tgtaagtgcg ttttctcgca ccacaatcta tttttcttat
    6501  gcgtctcctt agttgaagag gtgaacatga tcgcgaaaat tctagggggt
    6551  ttgtcgttct tctcacgacc aatatcatca gcgctggcat tcgttctttt
    6601  acagcccgag aggttcgttg agtactctgg aaagttgagc acgacttttt
    6651  tgttttttct caaaatttct cctcgcgtgc ctctcaagat caaagggttt
    6701  ttcgagtggg tagccggtaa tcctctattg aggggcgttc ggagattcct
    6751  tcgcttgatc gcggtgaagc tgaaccttcg aaggaagaga ggactgagaa
    6801  cgagaaatgg tggttacccc agccaaaggg ccgtgccggt tataccatct
    6851  aatcgcgtga caaatgacgg atgtgagaga ctgtctgaga agatgcaagg
    6901  agtcgaagca ctacgatccg aattaaggat tcttgaagaa cttgatgccg
    6951  cagtggtgga gaagctcaac aaacgcagga accgtgaagc ggatgatagc
    7001  gagttctcgc gccctatgca cgagagcacg catgatgtga cttccttttg
    7051  ttcaaaagcg aattcggtag gcacggccct cgaaagggcg gtgctcgtgg
    7101  aagatgcggt gaaatctgaa aagatctcga ggatggctaa agatctggtt
    7151  cgtaagggga ctgtttccga tgaggaaatc accaacactt tatctgatga
    7201  tgaagcgatt gaagaagttc cagtctccga agagcgcgac gactcaccca
    7251  aaacggtaag ggtgagtgaa tatttgaata gattgaactc aagcttcgaa
    7301  ttcccgaagc cgatcgtggt ggacgacaat aaggagactg gagggttaac
    7351  caacgcggta cgcgaattct actatatgca ggagctcgct ctatttgaaa
    7401  tccacagcaa actgtgcgct tactacgatc agttgcggat cgtgaatttc
    7451  gaacgctcta tggccccatg taatgaggat gctcagttgt acgttcgtaa
    7501  aaacggttcc acaatagtgc agggcaaaga tgtgcgttcg aacatcaagg
    7551  attttcacga tcacgatttt ctcttcgatg gcaagatctc cgtaaataga
    7601  cgacggcgat ctggaaacgt tctgtaccat gataaccttt cttttctggc
    7651  gagcaacctg tttctggcgg gatacccttt ttcacggagt tttgttttca
    7701  ctaactcttc ggtggatatt cttctttatg aagctcctcc cggtggtggc
    7751  aagaccacga ccctaataga ttccttcctg aaagttttca aaaaggggga
    7801  ggtatccacc atgatactaa ccgcgaacaa aagctcgcag gttgagattt
    7851  taaagaaggt tgagaaagat atttccaata tcgaatgcca gaaacgcaaa
    7901  gataagagaa ctccaaagaa gagcatatac accatcgacg cgtatttgat
    7951  gcaccacaga ggttgtgatg ctgacatact ttttatcgat gagtgcttta
    8001  tggttcacgc cggtagtgtg ttggcgtgta ttgaattcac taggtgccac
    8051  aaagttatga tcttcggaga cagtcgacag attcattata ttgaaagaaa
    8101  tgaactcgac aagtgccttt acggagacct tgacaggttc gtagacctgc
    8151  aatgtcgtgt ctacggtaac gtgtcgtacc gctgtccatg ggacgtctgc
    8201  gcctggttaa gcgttgttta tgacaacatg atcgccaccg ttaagggtga
    8251  aagcgaagga aaaagtagca tgcgcattaa cgaaatcaac tcggtggacg
    8301  acttagtccc cgacatgggt tctacttact tgtgcatgct tcagtctgag
    8351  aagttagaaa tcagtaagca tttcatccgc aaagggctct ctaaacttaa
    8401  tgtcttgacc gtgcacgagg ctcaaggtga gacatacgcg cgcgtgaatc
    8451  tggtgagatt gaaatttcag gaggacgagc cttttaaatc catcaggcat
    8501  ataaccgtcg cattatctag acacaccgac agcttgactt acaacgtcct
    8551  agccgctcgg agaggcgacg ccacgtgcga cgctatacaa aaagctaacg
    8601  agttggtgaa caagtttcgt gtcttcccga cttctttcgg tggtagcgtt
    8651  atcaatctcg acgttaagaa agatgtggag gacaacagta ggtgcaaagc
    8701  ttcttcggcg cctttaagtg tgatcaacga cttcttgagc gacgttaatc
    8751  ccggcaccac cgtaattgat ttcggagatc tctctgcaga ttttagcacg
    8801  ggacctttcg agtgtggcgc tagcggcatc gtcgtgcgag acaacatctc
    8851  ctccagcaac atcactgatc acgataagca gcgtgtttag cgcagtgcgg
    8901  tcgcaggcga ttccgcgcag aaagccttcc ctgcaagaga atctttattc
    8951  ttttgaagcg cggaattaca acttctcgac ttgcgaccgc tttacctcag
    9001  cttctatgtt cggtgaagcg atggctatga actgcatacg ccgctgtttt
    9051  gatttagaga ccttttcatc tttgcgcgat gatgtgattt ctatcacaag
    9101  gtcgggtatt gaacagtggt tggagaagcg tactcccagt caaataaagg
    9151  ctttgatgaa agatatcgaa tcaccgctgg aaattgatga tgagatctgc
    9201  aggttcaaat tgatggtgaa gcgtgatgct aaggtgaagt tagattcttc
    9251  ttgcctaacc aaacacagcg ctgctcagaa cattatgttt catcgtaaaa
    9301  gtatcaacgc gattttttca cccattttta acgaagtgaa gaaccgtatc
    9351  atgagctgtc ttaagcccaa cataaaattc ttcaccgaga tgactaatag
    9401  ggattttgct tccgttgtga gcaacatgct cggtgatgac gatgtttacc
    9451  atataggcga agtcgatttc tcgaagtatg acaagtctca ggatgctttc
    9501  gtgaaatcct ttgaagaagt catgtacaaa gaactcgggg ttgacgagga
    9551  actcttagcg atttggatgt gtggtgaaag gctttccatt gcgaatacgc
    9601  ttgacggtca gctgtctttc acgattgaga accagagaaa gtcgggtgcc
    9651  tcaaacacgt ggatcggtaa ttctcttgtt acgctgggca tactaagtct
    9701  ctattatgac gtgaggcatt ttgaggctct ctacgtctct ggtgacgact
    9751  ctctgatttt ttcacgcaac aaaatttcga attacgctga tgatatctgc
    9801  gctgatatgg gtttcgaaac gaagtttatg tctccgagtg ttccgtattt
    9851  ttgttccaaa ttcgtcgtta tgtgcggaca caagaccttt tttgtgcctg
    9901  atccgtataa gttattcgtg aaactgggag ctgtaaagga ggatgtctct
    9951  atggattttc tctttgaaac tttcacctcc tttaaggatt tgacttcgga
   10001  ttttaacgat gagcgcgtga ttcagaaact cgctgagctt gttgctctca
   10051  aatacgacgt tcagagtggt aataccactc tagcgttgag cgtgatacat
   10101  tgtttgcgtt ctaactttct atcgttcagc aaactgtacc ctcgtgtgaa
   10151  aggatggcag gttttttaca cctccgttaa gaaagcactt tttaagagcg
   10201  ggtgctcact ctacgaaagc tacgtcactc cattcggtca tgcagtgatg
   10251  gtgtgggatg atgagtagca cgctactctt gcgtagtttt gaacggtact
   10301  gtttccgcga ctgtgggatg atcacgtgac atacacgatg tgtgtcactg
   10351  tatagatatt atggaccagg ttctgcagtt cgagtgtctg tatctgctca
   10401  accaggcggt ttttgcaata acattcgtct tcattctgct catcattcgc
   10451  gtgattaaat ctttccgcag aaacgtacac gaaactccaa tatcggccgt
   10501  ccgtggtcag ggtttctcga ctgttgtgtg atttgcgaaa tggttgtttt
   10551  tggtttagat ttcggtacga ctttttcgac ggtctgcgtg tataaagatg
   10601  gtaaggttta ctcattcaaa caaaacaatt ctgcgtacat tccgacatac
   10651  ctctaccttt tctccgaaac taatcacatg gtttttggtt atgaagccga
   10701  atcactgatg cataatgcga aggtgagagg ctctttcttt agggacttaa
   10751  aacgctgggt gggttgcgac tccagcaact ttagtgacta ctttgatcgc
   10801  ctgaagccac actatgcggt tcgcccgtat aaaataggta ctggtctgaa
   10851  tgatacggtg attataggaa actacggggg taccgttcgt tccgaagtgc
   10901  atttgccagg actaatagct tcctttatca aggcgatggt tagttgtgcc
   10951  gagaatgcct tttcttgcac ttgcacggga gtaatatgtt cagtgccagc
   11001  gaattatgac agtgttcaga ggaatttcac tgatcagtgc gtttccttga
   11051  gtggttatca atgtgtgtac atggtcaacg aaccttccgc ggctgcttta
   11101  tcagcgtgca atctgataaa caagaagtcg gcgaacttgg ctgtatacga
   11151  ttttggaggt gggactttcg acgtgtctat tatttcctac cgcaacaata
   11201  cattcgtagt gcgcgcttct ggaggagatt taaatttggg aggaagggat
   11251  gttgacagag cctttctgac tcatcttttt tctctaacat ccttagaacc
   11301  cgatctttcg ttagacattt caaatctaaa agagtcgttg tctaaaactg
   11351  acgcggaaat agtttacacg ctaaaaggga gcgacgataa aagggaggat
   11401  gttagagtga ataaaagtat tctcactact gttatgctcc cttacgtcaa
   11451  tagaacttta aacattttgg aagcaacact taaatcgtac gcaaaaaata
   11501  tgggtgggtt acggagcgtt aaatgcgact tagtgctaat tggtggttct
   11551  tcgtatcttc cgggtttaga agatatctta tcgaaacacc gacggatcga
   11601  tcgaatattg aaagtcgctg atccccgagc ggcggtcgcg gtcggttgtg
   11651  cgctatattc gtcgtgcctt tcaggttcac aagggctgtt attagtcgat
   11701  tgcgcggctc acaccatcgc aatagccggt atgagctgtg accagattat
   11751  ttgcgctcca gctggagctc ctattccctt ctcggggacc acaccgttgt
   11801  acttaccaaa agctaataga aattcacaac gtcaaatcgc agtattcgaa
   11851  ggtgaatacg tgaagtgtcc cagaaataga aaaatttgcg gttcaaacat
   11901  taaatttctt gatatcggtg tcacaagcgt ttcacactca cccatcactt
   11951  tctatttaga cgtagccata tctagtgtgg gggctatctc gtttgtggtg
   12001  agaggtcccg aaggaaagga agtttccttg acgggcactc ccgcttacaa
   12051  cttttcttct gtagtactcg gaacacgtag tgtccgagag ttgcatatta
   12101  gtctaagcaa taaagttcat ctcggcctac ttctacaccg gaaggctgac
   12151  cggcggttac tattttccga aggtgaagcg gttcgctacg tggaaacagt
   12201  agaagttgcg gatgtgctaa aagaatttaa gagctacaac gctagttctc
   12251  taccaccaga cgaagatgtc gaaccactca tggggaagtc tgttcaaaaa
   12301  gtactacggg gaggcagatt ggaggaaata cctctctaag agcattgtag
   12351  cccacacagc taacataaaa actttgccgg acgttcagtt gtacggcggt
   12401  agaactgtga agaagtccga atttgaatcg gtgactccga ggtcgttcga
   12451  gcaggaatta ggacttctga tgttaagtga acgggacgtg ggttggtgta
   12501  agatgtgcgg gataactgtg gaggaggcaa tgtaccaaat cacgaaccct
   12551  gaagcgtatc cgatcacagc ggaaaaatgc gatccagatg tgaaaactga
   12601  ggggcagaaa tacaccatgg aagacgtgat gaatttcatg cgtcgttcca
   12651  acctagatat aaatgataaa atcttagcgg aacagtgttg gtctctatcc
   12701  aattcgtgcg gagttttgat taaccccgat gataaagaac ggtttgttgc
   12751  tctcactttt aagaataacg aattggttaa cgattcaagc aacgcgaaca
   12801  tagactgtcg cgtgggtgat tacttagttt acgctatgtc cctattcaat
   12851  tgtaggagtc agaagtcgca agcgggtaac atttcgctct acgaaaagta
   12901  ttgcgcttac atcagaactt acttagaaaa taccgatttg tatttcactt
   12951  ctcccgatag gataccgtta ctcaccggca ttctctatga tttctgcaag
   13001  gagtataata tcttttattc cacatacaaa cgaaacgttg ataatttcag
   13051  gttcttccta acgaattata tgcccttgat ttcagacata ttcgttttcc
   13101  agtgggtaaa accggcaccg gacgtgagat tactattcga tataagcgca
   13151  gccgaattga ctttagaagt tccaacgtta agcttagtgg attcgcaggt
   13201  ggtgatagga catgtcctga gatttgtcga atcatacact gctgatccgg
   13251  ctattgacgc gttggaagag aaattggacg ctataatgaa gaagagtaat
   13301  cctcatctat ctacggcgca actgtgggta ggattcttct gctattacgg
   13351  cgaatttcgc accgcacaac gtcgggtggt gcaaaggccg ggtgtgtata
   13401  agacgcccaa ttcggtcgga ggtttcgaga ttaatatgaa aaacgtcgaa
   13451  gagttttttg ataagatcca acgagaggtg ccaaacgtgt ctctgcggcg
   13501  acaattcaac ggagccagag cgcacgaggc attcaaagta tttaaaaagg
   13551  gaaacatcag cttcaaaccc atatctcggt taaacatacc gagggagttc
   13601  tggtatctga atgtggatta ttttagacat gcgaacagaa gcggactgag
   13651  cgaagaggag gtgctcattc ttaataatat aagcgtagat gttcgtaaat
   13701  tgtgtgcgga aagagcgtgc agcactctgc ctagcgcgaa gcgctttagc
   13751  aaaggtcata aaagtagtgt gccatcattg cgtcaagaga aaaattatag
   13801  agatccgttg atcacgttaa gaaactcttt atatgagttc cggcacggga
   13851  atcgcgatag gagggtctga ggccatcgag acctcaggtt tcgtgctatc
   13901  tacgcgaaag gaagccgtcg ataagttctt caatgaacta aggaacgaaa
   13951  attattcttc ggtcgacagc agtcggttaa gcgaccaaga ggtgaaagaa
   14001  gttctggaga aaagtaaaga gagctttaaa agcgaattag cgtccaccga
   14051  cgaacacttc gtttatcaca tcatcttctt tctgattcga tgcgccatta
   14101  tatccacgag cgataaggta aaatacgtag ggagccataa gtacgtagtc
   14151  gaaggaaaga cgtacacagt tcaagacgtt tgggttttta acatgattaa
   14201  ggggctgacc aagcagtaca aaagggtgaa tggtttgcgt gctttctgtt
   14251  gtgcctgtga agatttgtat ctgacagttg ctcccgcgat gtctgaacgc
   14301  ttcaaaacca aggctatcgg tatgaagggc ctacccgtcg gaaaggagta
   14351  tttaggtgct gactttctct ctggaacgag tagattgatg agtgatcacg
   14401  atagagctgt atccatagtc gcggccaaga acgctgtcga tcgtagcgca
   14451  tttaccggtg gagagaggaa gatagttagt ttgtatgact taggaaggaa
   14501  ctaagcacgt tgtgctatag tgcgcgtcat aatattaagt actagtgcat
   14551  attaacaagc agtagtgttt aaagtgtagt gataagaaac aatggagttg
   14601  atgtccgatg ataacttgag cggtctcgtc ataaccgacg cttctagttt
   14651  gaatggtgcc gataagaaac tgctgtctgc ggaggtcata aaaatgcttg
   14701  tgcagaaggg ggcgcccagc gaaggtattg aaatagtctt tgggctactg
   14751  ctctacgctc tcgcagcgag aaccacatcg cccaaagttc agagggctga
   14801  ttctgatata atctttcaaa acacttacgg tgacaagact gttgtcgtga
   14851  cagaaggtga tctcaagaaa gtgcttgaag ggtgcgcacc tcttaataga
   14901  ttcactaaca agccgcgaac tttcggccgc acgtttacgg aggcgtatat
   14951  tgatttctgc gtggcttaca agcataagat gcctcagctc aacgcggccg
   15001  caaatttggg gataccagca gaagattcgt acctagctgc ggacttttta
   15051  ggtgcttgcc cgaaactctc tgaattacaa caaagtagaa aaatgtttgc
   15101  aagtatgtac gctttgaaga ctgaggacgg agtagtaaat acgcccgtta
   15151  gtaatttgcg ccaattaggt aggagagaag ttatatgatg gaaatttgcg
   15201  ctcagaatcc tgaggcacta gtgctattac gcacaaatca aaacacaaca
   15251  ttactagtcg tcaagtctga tgatgaagtt aatctgccga aattgttgat
   15301  atgcgggtat ttacgcgtgt cgcatcgtgg ggatgtgact ggttgtaatc
   15351  gcgaagacat aataaaggat tttgaaggtg cacatcatac cgtcatccgc
   15401  tcgagaacgg tacagtatga ttacgagtcc gcagttaaag agtacaataa
   15451  cgctgattgc gtggtgaaat tctttttaga aacaggagac gttttttggt
   15501  tttttctcca aagtgacatc aaaggaagag cggcgcgaca cttgcgcacc
   15551  ttcttcgaag ctaacaattt cttctttgga tcgcattgcg gtaccatgga
   15601  gtattgtttg aagcaggtac tgatagaaac tgagtctgta atcgaatctt
   15651  tttgtgaaga aagaaatcgt taagatgagg gtaatagtat ctccttatga
   15701  agctgaagac attctaacaa gatcaactga aatgttgcga aacatagaca
   15751  gtggagcgtt ggatacgaaa gagtgcattg aagcgttctc gacgctaacg
   15801  cgagatttgc actgcgcaaa agcatcgtac caatggtgcg ttgacacagg
   15851  gttgtgccga cgtgattgcg ccgaaaaacg cttgatcgac accgttgaat
   15901  caaatctgag actcgctcaa cctctcatac gcgagaaggt ggcgactcat
   15951  ttttgcaaag atgaacccaa agaactagtg gcgttcatca cgcggaaata
   16001  cgttaagctc acaggtgtgg cggcgcggga ggctgtaaaa atagaaatgc
   16051  gcactctatc taagacagtt ttaaataaac tatctttaga aatggccttc
   16101  tatatatcac ctcgagcgtg gaaaaacgca gaatggttag atctcaggta
   16151  tacgcctcta aaaatataca gagatctttt actagacgtg gacacactca
   16201  acgccttatg cgaggaggat gaagttcacg tcgtcgtgac caataaagat
   16251  gaagacgaga atcatgatct cgagcttcaa gaagactgtt aaagtctaaa
   16301  attctagaat cgcaatatgt ttgcgagtag taaataaaat cgaacgtggg
   16351  tggatctacc tgacgtatca actttagctg ttactgggta attaagctaa
   16401  caagtgttag cgtaatgtgt atgttgatga agagaaaata ccgtttctag
   16451  atcggtgact tttctcttct tttattttta aaataaaaa