Sequence of DPV Melon necrotic spot virus

Melon necrotic spot virus strain Hyd, complete genome.

ACC No: JX879088

Dated: 2013-01-10 | Length: 4274 | CRC: -259650604

                
ID   JX879088; SV 1; linear; genomic RNA; STD; VRL; 4274 BP.
XX
AC   JX879088;
XX
DT   10-JAN-2013 (Rel. 115, Created)
DT   10-JAN-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Melon necrotic spot virus strain Hyd, complete genome.
XX
KW   .
XX
OS   Melon necrotic spot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4274
RA   Nagateja N., Gopinath K.;
RT   "A novel virus infecting Cucumis melo is a member of carmovirus from
RT   India";
RL   Unpublished.
XX
RN   [2]
RP   1-4274
RA   Nagateja N., Gopinath K.;
RT   ;
RL   Submitted (29-SEP-2012) to the INSDC.
RL   Plant Sciences, HCU, Gachibowli, Hyderabad, Andhrapradesh 500046, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4274
FT                   /organism="Melon necrotic spot virus"
FT                   /host="Cucumis melo"
FT                   /lab_host="Nicotiana benthamiana"
FT                   /strain="Hyd"
FT                   /serotype="Japan"
FT                   /mol_type="genomic RNA"
FT                   /country="India"
FT                   /collection_date="2009"
FT                   /db_xref="taxon:11987"
FT   5'UTR           1. .98
FT   CDS             99. .2495
FT                   /codon_start=1
FT                   /transl_except=(pos:924. .926,aa:OTHER)
FT                   /product="p89"
FT                   /note="putative RNA-dependent RNA polymerase"
FT                   /protein_id="AGC04692.1"
FT                   /translation="MATAMNTMGLTVLNLAPVQSSHIITRCFAARSVDSTLPSKDICTR
FT                   LSNSLCENVKSDIASIVKVGLGAAVCYGAYRLAKNFWYNQRKHSKGEIDELGQAVLKCI
FT                   EDVANGNDEAIEEETTETIMVGDVDIGVVREIPAEVRLKRRHRKAPFLAKVTNMAKNHF
FT                   GGCPDPTKSNVMAVSKFVYDTCKEHNCLPHQTRQIISIVVPLVLSPDEYDITSRALLNS
FT                   DILCENRAKRESASSISGWLVNLIAHPLSATAWRRAMDNLCGLPDWKAFRLVNXGCLEE
FT                   LAGFCTEVRRGQHPDMTEHSSGRPVKVRRLFCLGGVGTSVRFGVHNNSLQNLRRGLLER
FT                   VFYVENENKELEPAPKPLDGAFGSLLRFRRKLHSIVGTHSRVSPNQFVEFYSGRKKTIY
FT                   QQACESLEGLAVQKRDSYLKTFVKAEKLNITRKPDPAPRVIQPRNVRYNVEVGRFLRRF
FT                   EHYLYRGIDTIWGGPTVIKGYTVEQIGEIVSDAWFSFRSPVAIGFDMKRFDQHVSVDAL
FT                   KWEHSVYLDAFCNDEYLKELLSWQLENRGVGYASDGYIKYKVDGCRMSGDMNTAMGNCL
FT                   LSCAIVYQFFKEYGIKGRLINNGDDCVVFVEKECAAAVKAGIVKHWRKFGFQCELECDA
FT                   NIIEQVEFCQMRPVKVNGKYIMVRNPLVSLSKDSYSIGPWNSINHAKKWVNAVGQCGIS
FT                   LTGGVPICQSYYQMFIRNTSGVNSNSILRDVSFASGFRELAKMGKRVATDISEESRFSF
FT                   YLAFGITPDSQRAIESDYDAHNFDWGFWPQGKPKIEPISWMLNEL"
FT   CDS             99. .926
FT                   /codon_start=1
FT                   /product="p28"
FT                   /protein_id="AGC04688.1"
FT                   /translation="MATAMNTMGLTVLNLAPVQSSHIITRCFAARSVDSTLPSKDICTR
FT                   LSNSLCENVKSDIASIVKVGLGAAVCYGAYRLAKNFWYNQRKHSKGEIDELGQAVLKCI
FT                   EDVANGNDEAIEEETTETIMVGDVDIGVVREIPAEVRLKRRHRKAPFLAKVTNMAKNHF
FT                   GGCPDPTKSNVMAVSKFVYDTCKEHNCLPHQTRQIISIVVPLVLSPDEYDITSRALLNS
FT                   DILCENRAKRESASSISGWLVNLIAHPLSATAWRRAMDNLCGLPDWKAFRLVN"
FT   gene            2474. .2677
FT                   /gene="MP-1"
FT   CDS             2474. .2677
FT                   /codon_start=1
FT                   /gene="MP-1"
FT                   /product="p7A"
FT                   /note="movement protein 1"
FT                   /protein_id="AGC04689.1"
FT                   /translation="MDAQRTVDQTNSRGRSQEKSNSDKVGNSKTSMGRKIANDAISESK
FT                   QGVMGASVYIADQIKVKINFNF"
FT   gene            2680. .2868
FT                   /gene="MP-2"
FT   CDS             2680. .2868
FT                   /codon_start=1
FT                   /gene="MP-2"
FT                   /product="p7B"
FT                   /note="movement protein 2"
FT                   /protein_id="AGC04690.1"
FT                   /translation="MGCGCCSQYCPGDYSGVVAILFLLLILFVITILGQPTQHTYTTYD
FT                   NSCIKTQYVGISTNGDG"
FT   gene            2855. .4030
FT                   /gene="CP"
FT   CDS             2855. .4030
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="p42"
FT                   /note="coat protein"
FT                   /protein_id="AGC04691.1"
FT                   /translation="MAMVKRANNSNNNKAIIPYGPILKSLGPVAASKAGEYAPVVINGV
FT                   TKLTKSARRLLGKGNENITFTSGAYPGSVSAPVAISRRIAGMQPRFKQVAGSIHITHRE
FT                   LVTSILPSSDLLVNNGVTTVGAYRINPGNATLFTWLPTLGLNFDMYKFTRIRFHYVPTC
FT                   ATTSTGRVALVWDKDSQDPLPVDRSALSAYTHSAESAPWADNMLVIPCDNIKRFINDGN
FT                   ATDKKLVDFGQLFFATYSSSGGVPLGDVYVEYGVEFTEAQPAASQVQYFERTLSAGLTG
FT                   LFTRGANYISDADVKTVNNSSCEINVNVPGTFLFTLVINASTVTNISIGGNSTSRGPVL
FT                   GSGASTAIFTGVIASSGVPSSPASITVNGLVGLLRLRCTITRATSEVAYLV"
FT   3'UTR           4031. .4274
XX
SQ   Sequence 4274 BP; 1104 A; 922 C; 1053 G; 1195 T; 0 other;

jx879088 Length: 4274  10-JAN-2013  Type: N  Check: 4393  ..

       1  gggatagcta gccactattc ccgtgctctc tgtgttcgag atcccgtgtc
      51  ggcaggttac tttgatcgta atatcggcgg acctaaacgt aacagcgtat
     101  ggctactgca atgaatacta tggggttaac tgtgcttaac ttagctcccg
     151  tgcaatcttc tcatataata actagatgct ttgctgcgag aagtgttgat
     201  agtactctac ctagtaaaga tatatgtact aggttgtcaa atagtttatg
     251  tgagaatgtc aaatctgata tcgcttctat tgttaaagtc ggacttggag
     301  ccgctgtttg ttatggtgct tataggttgg caaagaactt ttggtacaac
     351  cagcggaaac actctaaggg tgagattgac gaattagggc aggccgtttt
     401  gaaatgcatt gaagatgtgg caaacggcaa cgatgaggcg attgaggagg
     451  agaccacgga aactatcatg gttggtgatg ttgatatcgg ggtagtgcgt
     501  gagatccccg ccgaagtcag attgaagagg agacatcgga aagctccctt
     551  cctggctaag gtgacaaata tggccaaaaa tcattttggc ggttgtcccg
     601  atcctacaaa atcaaacgtg atggctgtga gcaaatttgt ctatgacacc
     651  tgtaaagaac ataattgcct tccccatcag accagacaaa ttattagtat
     701  cgttgtccct ctcgtactca gccctgatga gtacgatatc acgagtcggg
     751  ctcttttgaa ttctgatatt ctatgcgaga acagagctaa gcgtgagagt
     801  gcgtcctcca tcagtggatg gttggtcaat ctaattgccc atccattgtc
     851  cgccactgct tggaggcgtg ccatggacaa cctgtgtggt cttcctgact
     901  ggaaggcctt caggcttgtc aactaggggt gcctagagga gctcgcggga
     951  ttctgcactg aagtgcggag agggcaacat cccgacatga ccgagcattc
    1001  ctcaggacgc cctgtcaaag tacgtagatt attttgctta gggggagttg
    1051  gaactagcgt acggttcggt gtccacaaca attctttgca gaaccttcgg
    1101  agaggtttgt tagaacgtgt gttctacgtg gaaaatgaaa acaaagaatt
    1151  ggaacctgcc cctaagcccc tggatggtgc ttttggaagc cttttgcggt
    1201  tcaggcgtaa gttgcactca attgtcggta ctcattcccg agtatctccc
    1251  aaccaatttg tggagttcta ctcaggcagg aagaaaacaa tataccagca
    1301  agcttgcgaa tcgcttgaag gactggctgt ccagaagaga gattcctatc
    1351  tcaagacctt tgttaaggct gagaaattga acatcaccag gaaacctgac
    1401  cctgctccga gggtgatcca accgaggaac gttcgttaca acgttgaggt
    1451  tggtcggttt ttgagaaggt ttgagcatta cctctataga ggcattgata
    1501  caatctgggg tggtcccacc gttattaagg gttacactgt agaacaaatt
    1551  ggcgagatcg tttctgatgc ctggttttct ttccgaagcc cagtagccat
    1601  cggtttcgat atgaaaaggt ttgatcaaca cgtcagtgtg gatgcactta
    1651  agtgggaaca ctccgtctat ttggatgctt tttgtaatga tgaatatctg
    1701  aaagaattac tatcttggca actggaaaac cgtggtgttg ggtatgctag
    1751  tgatgggtac attaaatata aagttgatgg ctgcagaatg agcggagata
    1801  tgaatactgc tatgggaaat tgtttgttat cgtgtgccat tgtgtaccag
    1851  ttctttaaag aatatgggat taagggtaga ctcataaata atggagatga
    1901  ttgcgtcgta ttcgtcgaaa aggaatgtgc tgcggcggtt aaagccggca
    1951  ttgtaaagca ctggagaaag ttcgggtttc aatgtgaact cgagtgcgac
    2001  gccaatataa tcgaacaagt tgagttttgc caaatgagac ccgttaaagt
    2051  taatggcaag tacatcatgg tgcgcaatcc cttggtaagc ttatctaaag
    2101  attcttactc catcggtccc tggaattcca tcaaccatgc caagaaatgg
    2151  gttaatgcag ttggccagtg cggcatctcc ctcactggcg gtgttcctat
    2201  ctgccaatca tattaccaga tgttcatccg caatacatca ggcgtgaatt
    2251  caaatagtat cctccgcgat gttagttttg caagtggatt ccgggaactc
    2301  gcgaaaatgg gcaaacgtgt tgcaactgac atatctgagg agtcaaggtt
    2351  tagcttttat ctcgcatttg gcattactcc agactcgcaa cgtgccattg
    2401  aaagtgacta tgatgctcat aactttgatt ggggcttctg gccccaggga
    2451  aaaccaaaaa tcgaaccaat ttcatggatg ctcaacgaac tgtagatcaa
    2501  acgaactctc ggggaagatc gcaagagaaa tcgaatagtg acaaggtggg
    2551  aaactcaaag acttcaatgg ggcggaagat agccaatgat gctatctcgg
    2601  agtctaaaca aggtgttatg ggtgcttctg tttatatcgc agatcagatc
    2651  aaagttaaaa ttaattttaa cttctgataa tggggtgtgg atgttgctct
    2701  cagtattgcc ccggggatta ctctggagtc gttgcaatac tttttctcct
    2751  gttgatactc tttgtcatta ccatcttagg tcagccaact caacacacat
    2801  acactactta cgataactct tgcattaaaa cacaatacgt aggaatctca
    2851  acgaatggcg atggttaaac gcgcaaacaa tagtaataat aacaaggcga
    2901  ttattcccta tggaccaatt ttgaagtctc taggccctgt tgctgccagc
    2951  aaagctgggg aatatgctcc tgtggtcatt aatggtgtca ctaaactcac
    3001  caagtccgct cgtcggctgt tgggtaaagg gaatgaaaac atcactttta
    3051  ctagtggtgc ctatcccgga tcagttagtg ctccagttgc gatcagtagg
    3101  agaattgctg gtatgcagcc tagattcaag caagtggctg ggtcaataca
    3151  catcactcat agagaactag tgacttctat cctccctagt agtgacctac
    3201  tggttaacaa tggtgttacc accgttggtg cctatcgcat caaccctggc
    3251  aatgccaccc tgttcacctg gttaccaaca ttagggttaa actttgatat
    3301  gtacaaattt accagaatta gatttcacta tgttcccacc tgcgcaacta
    3351  ctagtacagg gcgggtcgct ctcgtctggg ataaggattc tcaggatcct
    3401  ctcccggtag atcgatctgc actttcagca tacacgcata gcgcagagag
    3451  tgctccttgg gcagataaca tgctggtcat cccatgcgac aacattaaaa
    3501  gattcatcaa tgatggaaat gctactgata agaagttggt tgactttggt
    3551  caactcttct tcgctactta ctcaagtagt ggtggtgttc ctcttggtga
    3601  cgtttacgtt gagtatggtg ttgaattcac tgaagctcag ccggcagcgt
    3651  ctcaggtgca atacttcgag agaacgttgt ccgctgggtt aaccggcctg
    3701  ttcactaggg gcgctaacta tatctctgat gctgatgtta aaactgtcaa
    3751  caattcgtct tgtgaaatta acgtgaatgt tcctggaaca ttcctgttca
    3801  ccctcgtcat taatgctagc actgttacta acatttccat tgggggcaac
    3851  tctacctctc gcggtcccgt tctaggttcc ggtgcttcta ccgctatctt
    3901  tactggggtt atcgcttctt ccggggtacc gagttctcca gcctccataa
    3951  cggttaatgg tcttgttggc ctgctcaggc tacgctgcac cattacccgc
    4001  gcaaccagtg aggtagctta ccttgtatag tccttcacgt tcttgggttc
    4051  cgtgttccag gccctccagc ccaactcatt ctatctgttt gtcatggtgg
    4101  tacgacccct tcctcggcgg gaagggactg cgtaggatgg caagttgctc
    4151  tagatgaggt aagtaggtcc tgagatcggt ttctgggaaa gctctttggg
    4201  gaaaacacag caatgtgggg cgcccgtgga gagtatgtca tgtttgaatt
    4251  gaggccactt aagtggcccc gcca