Sequence of DPV Rice yellow mottle virus
Rice yellow mottle virus isolate Mg66 coat protein (CP) gene, complete cds.
ACC No: JX961577
Dated: 2012-12-16 | Length: 720 | CRC: 834455749
ID JX961577; SV 1; linear; genomic RNA; STD; VRL; 720 BP. XX AC JX961577; XX DT 16-DEC-2012 (Rel. 115, Created) DT 16-DEC-2012 (Rel. 115, Last updated, Version 1) XX DE Rice yellow mottle virus isolate Mg66 coat protein (CP) gene, complete cds. XX KW . XX OS Rice yellow mottle virus OC Viruses; ssRNA positive-strand viruses, no DNA stage; Sobemovirus. XX RN [1] RC Publication Status: Available-Online prior to print RP 1-720 RX PUBMED; 23123216. RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT "Rice yellow mottle virus in Madagascar and in the Zanzibar Archipelago; RT Island systems and evolutionary time scale to study virus emergence"; RL Virus Res. 0:0-0(2012). XX RN [2] RP 1-720 RA Rakotomalala M., Pinel-Galzi A., Mpunami A., Randrianasolo A., RA Ramavovololona P., Rabenantoandro Y., Fargette D.; RT ; RL Submitted (11-OCT-2012) to the INSDC. RL RPB, IRD, 911 av Agropolis BP 64501, Monptellier 34080, France XX CC ##Assembly-Data-START## CC Sequencing Technology :: Sanger dideoxy sequencing CC ##Assembly-Data-END## XX FH Key Location/Qualifiers FH FT source 1. .720 FT /organism="Rice yellow mottle virus" FT /host="Oryza sativa" FT /isolate="Mg66" FT /mol_type="genomic RNA" FT /country="Madagascar" FT /collection_date="2004" FT /db_xref="taxon:31744" FT gene 1. .720 FT /gene="CP" FT CDS 1. .720 FT /codon_start=1 FT /gene="CP" FT /product="coat protein" FT /protein_id="AFZ75360.1" FT /translation="MGRKGKKINSNQGQQGKKKSRRPRGRSAEPQLQRAPVAQASRISG FT TVPGPLSSNTWPVHSVEFLMDFKRSATSADAVAFNCVPFNLPRVWSLARCYSLWKPTRW FT DVVYLPEVSAATAGSIEMCYLYDYADAIPSDTGKMSRTAGFVTSSVWYGAEGCHLLNGG FT SARNAVVASMDCSRVGWRRVTSSIPSSVDPNVVNTILPARLAVRSSIKPAIDDVPGKLY FT AIVSMVLRDPVDPTLNT" XX SQ Sequence 720 BP; 153 A; 182 C; 221 G; 164 T; 0 other; jx961577 Length: 720 16-DEC-2012 Type: N Check: 1167 .. 1 atgggcagga agggcaagaa aatcaactcc aaccaaggcc agcaaggcaa 51 gaagaagagc cgacgtcctc gtgggcgttc ggcggagccc cagcttcaac 101 gggctccagt ggctcaggcg tcccggatat ctgggacggt tcctggacca 151 ctatcttcta atacctggcc ggtccactcc gtggaattcc tgatggattt 201 taagcggagt gccacatcgg cggatgcggt agcatttaat tgtgtgccgt 251 ttaatctgcc tcgggtgtgg agtcttgcac gttgttactc gttgtggaag 301 ccaacacggt gggatgtagt ttacctcccc gaggtgagcg cggcgacggc 351 tggaagtatt gagatgtgtt atctctacga ctatgccgat gctatcccaa 401 gtgacacggg caagatgagc aggacggcgg gcttcgtcac ctctagcgtt 451 tggtacggcg cggagggctg ccatttgttg aatggcggtt cagcacggaa 501 tgccgtggtc gcctcgatgg attgctctcg agtcggctgg agacgcgtaa 551 ctagttcgat tcctagtagc gtggatccca acgtcgtaaa taccatactg 601 ccagcaaggc tagctgtgcg gtcgtcaatc aaaccggcga tcgacgatgt 651 gccggggaaa ctctatgcta tcgtcagtat ggtcctgcgg gatccggttg 701 atccaacact caatacgtga