Sequence of DPV Rosa rugosa leaf distortion virus

Rosa rugosa leaf distortion virus isolate MN-3, complete genome.

ACC No: KC166238

Dated: 2013-02-25 | Length: 3971 | CRC: -1060981424

                
ID   KC166238; SV 1; linear; genomic RNA; STD; VRL; 3971 BP.
XX
AC   KC166238;
XX
DT   25-FEB-2013 (Rel. 115, Created)
DT   25-FEB-2013 (Rel. 115, Last updated, Version 1)
XX
DE   Rosa rugosa leaf distortion virus isolate MN-3, complete genome.
XX
KW   .
XX
OS   Rosa rugosa leaf distortion virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae.
XX
RN   [1]
RP   1-3971
RA   Mollov D., Lockhart B.;
RT   "Complete genome sequence of Rosa rugosa leaf distortion virus";
RL   Unpublished.
XX
RN   [2]
RP   1-3971
RA   Mollov D., Lockhart B.;
RT   ;
RL   Submitted (13-NOV-2012) to the INSDC.
RL   Plant Pathology, University of Minnesota, 1991 Upper Buford Circle, St.
RL   Paul, MN 55108, USA
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3971
FT                   /organism="Rosa rugosa leaf distortion virus"
FT                   /host="Rosa rugosa cv. Charles Albanel"
FT                   /isolate="MN-3"
FT                   /mol_type="genomic RNA"
FT                   /country="USA:Minnesota"
FT                   /collection_date="Jun-2009"
FT                   /db_xref="taxon:535898"
FT   5'UTR           1. .6
FT   CDS             7. .2292
FT                   /codon_start=1
FT                   /transl_except=(pos:718. .720,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="p87; readthrough protein"
FT                   /protein_id="AGF70694.1"
FT                   /translation="MSLFFELAYLTAKAGFVVAKELALLATQIRNDEIVHIDVQTDRVR
FT                   RVFGIQGREIIPTSDCTDLLNATQDLVVADPDLHEEECLEDIKEEVKGDGGEVSQKVVR
FT                   RRVRKKLPFACILAADAKNHFGGVPSACRANELSVTKYLVSKCKERKLTVLQTRQVSSL
FT                   AFCLVFTPDSNDKSIYQFLNSESVFERRCDYLKSQSVESCWMQLFSSPWNPKAWRRVIL
FT                   RLSSLGPQEAFRFVKXGCLMETCGVDTKVFRGEHHWVKEGREAALPPPRKLYKISGLSP
FT                   QVNWGVHNSSFVNLRRGLMERVFFVERQGKLAECPQPEKGAFRDLFNRVGHRLVRLCGN
FT                   HSPIPRSEYPLLHEGRKRTIYENAVKSLEIAPYCRKDSYLKTFVKCEKLNFSKKPDPAP
FT                   RVIQPRSPRYNVELGRYLKPFEHFLYRGLDRLWGGPTVMKGYTVQQMGRILRDKWNQYR
FT                   RPAAIGFDMSRFDQHVSVDALRFEHRVYRECFSNDENLSRLLEHQIANSGVAYAKDGWL
FT                   KYQVEGKRMSGDVNTAAGNCLLACCITYHLMQAAGISCSLVNNGDDCVVFLESEHCRAV
FT                   EDILTEGWLKFGFTCIAERPVFELEKVEFCQMQPVLVGGDYCLVRNPRVSLSKDAHSTT
FT                   PFDSVKLAREWAYSIGRGGLSLTSGVPVVQEFYQCLLRNGKQHSKRKRTAHFYGDYYAK
FT                   WVDQHRGEYTAVSQESRHSFHLAFGISPDQQVAMENAYSELELVFEFAPFRNEINVFEW
FT                   TINHPVVI"
FT   CDS             7. .720
FT                   /codon_start=1
FT                   /product="replicase protein"
FT                   /note="p27"
FT                   /protein_id="AGF70698.1"
FT                   /translation="MSLFFELAYLTAKAGFVVAKELALLATQIRNDEIVHIDVQTDRVR
FT                   RVFGIQGREIIPTSDCTDLLNATQDLVVADPDLHEEECLEDIKEEVKGDGGEVSQKVVR
FT                   RRVRKKLPFACILAADAKNHFGGVPSACRANELSVTKYLVSKCKERKLTVLQTRQVSSL
FT                   AFCLVFTPDSNDKSIYQFLNSESVFERRCDYLKSQSVESCWMQLFSSPWNPKAWRRVIL
FT                   RLSSLGPQEAFRFVK"
FT   CDS             2069. .2287
FT                   /codon_start=1
FT                   /product="putative 8 kDa protein"
FT                   /note="p8"
FT                   /protein_id="AGF70695.1"
FT                   /translation="MATIMLSGWISTGVNTLLSLKSRDIVFTSRLGSARISKLLWKMHI
FT                   RSWSLYSNSPHLETKSTFLNGQSTTQS"
FT   CDS             join(2262. .2437,2439. .2610)
FT                   /codon_start=1
FT                   /ribosomal_slippage
FT                   /product="p12"
FT                   /protein_id="AGF70699.1"
FT                   /translation="MDNQPPSRDLSVDRTQKRGKRKNNLDVAHSGVAKSASASLVGASF
FT                   VTVAETASFVVTLNFEVDLRLAPPNLLVAIVLCIFFSSVLSNGNSVSYYYQANSTSDKF
FT                   ITVSVGNGSSG"
FT   CDS             2262. .2444
FT                   /codon_start=1
FT                   /product="putative movement protein"
FT                   /note="p6"
FT                   /protein_id="AGF70696.1"
FT                   /translation="MDNQPPSRDLSVDRTQKRGKRKNNLDVAHSGVAKSASASLVGASF
FT                   VTVAETASFVVTLNF"
FT   CDS             2594. .3613
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="p37"
FT                   /protein_id="AGF70697.1"
FT                   /translation="MAAADSPQVIQAASAGAQWAIKLRAKGWRSLTKLQKAQARTHGVG
FT                   PVTPATIVPKVTRLVNGNPGNVRRRNGEPGNAMKSMTITKQEYLGTISAGGGVKTFILD
FT                   PRNVRSFPQLSAFCLGYNKYKFTKLAFRYSPRVNDTTAGIICAYTSDSSDEAPRSKYQM
FT                   YSINPRYEAVASKPLIVSIPPTKEPKFLRDKSSDDAKLVDSGSIHCLIDGDHEGKLGEI
FT                   FLDLTVVLSEPTFNQCSMQEVTKTRHIKGPGYVQPSFQDGVVTLTFQASGSYLCTYSCA
FT                   PITSLSQTGMEEAARVTTTSTEESSGFVEVVTEEPLSSVKFQFLNPASSKFHAYVTRM"
FT   3'UTR           3614. .3971
XX
SQ   Sequence 3971 BP; 953 A; 950 C; 1071 G; 997 T; 0 other;

kc166238 Length: 3971  25-FEB-2013  Type: N  Check: 1249  ..

       1  caaactatga gtttgttttt cgaacttgcc tacctgacag ccaaggctgg
      51  gtttgtggta gctaaggagt tggcgctcct agccacccaa atccgcaacg
     101  atgagattgt gcatatcgat gttcagacag accgagtgag gagggtcttc
     151  ggcattcagg ggagggaaat cattcctacc tccgactgca ctgaccttct
     201  caacgccacc caggacttgg tggttgctga ccctgacctc cacgaggaag
     251  aatgcctcga agatatcaag gaggaggtca agggggacgg tggtgaggtg
     301  tcccagaagg ttgtgaggag gagggtaagg aagaaattgc ccttcgcctg
     351  catccttgcc gcggacgcca agaaccactt tggaggagtt ccatcagctt
     401  gccgtgccaa cgaattgtcg gtgaccaagt acttggtctc caaatgcaag
     451  gagcgcaagt tgaccgtgct gcaaacccgg caggtctcat cgctggcgtt
     501  ttgccttgtt tttacacctg actctaacga taagtcaatc taccagttcc
     551  tgaacagtga gtccgtgttt gagcgtagat gtgactactt gaaaagtcaa
     601  agtgttgaaa gctgctggat gcagctgttc tcttccccgt ggaatccaaa
     651  ggcttggcgg agggtgatcc tccgtctgag cagcctgggg cctcaagagg
     701  ccttcaggtt tgttaaatag gggtgcctca tggagacctg tggtgtggac
     751  acgaaagtgt tccgaggaga acaccactgg gttaaggaag gccgtgaggc
     801  ggctctccct cctcctagga agttgtataa gattagcggt ctgtcccccc
     851  aggttaactg gggtgttcat aatagtagtt ttgtcaacct tcgtcgtggg
     901  ctcatggagc gggtcttctt tgttgagaga caagggaaac ttgctgagtg
     951  tccccagcct gagaagggag cgtttaggga tcttttcaat agggtcgggc
    1001  acagacttgt tagattgtgt ggaaatcatt cccccatccc gaggagcgag
    1051  tatcctctgt tgcatgaggg caggaagcgc acgatctacg agaatgctgt
    1101  caaatcctta gaaattgccc cctactgtag gaaagatagt tatcttaaaa
    1151  cgtttgttaa gtgtgaaaag cttaatttta gtaagaagcc tgatccagct
    1201  ccaagagtca ttcagccgag gagtccgcga tacaacgtgg agttgggtcg
    1251  gtatttgaaa ccgtttgagc actttttata cagaggatta gataggttgt
    1301  ggggcgggcc taccgttatg aagggctaca cagttcaaca aatgggtcgc
    1351  atcctacgag acaagtggaa tcagtaccgg aggcctgctg cgattgggtt
    1401  tgacatgagt cgatttgacc agcatgtttc cgtggacgcc ttgaggtttg
    1451  aacacagggt gtaccgcgag tgcttcagca acgatgagaa tttgtccaga
    1501  ttattggaac atcaaatcgc aaattccggg gttgcgtacg ccaaagatgg
    1551  ttggctgaaa taccaagttg aagggaaaag gatgagtggg gacgtgaaca
    1601  ccgctgccgg gaattgcctc ttggcctgtt gcatcaccta ccacctaatg
    1651  caagctgctg gcatcagctg ttctctcgtt aataatgggg atgattgtgt
    1701  tgtgtttctt gagtctgagc attgtcgcgc cgtcgaggat atcttgacgg
    1751  aggggtggct caagttcgga ttcacctgca tagctgagcg tcccgttttt
    1801  gaattggaga aagttgagtt ctgtcaaatg caacctgtgt tggtgggcgg
    1851  cgattactgc cttgtgcgca acccccgtgt gagcctgagc aaggatgcgc
    1901  actcaaccac cccctttgac tcggttaaat tagctaggga atgggcgtac
    1951  agcattgggc gcggagggtt aagtttgacc tcgggagtcc cagttgtcca
    2001  ggagttttac cagtgccttt tgcgtaacgg gaagcaacac tccaaaagga
    2051  aaagaacagc gcacttctat ggcgactatt atgctaagtg ggtggatcag
    2101  cacaggggtg aatacactgc tgtctctcaa gagtcgagac atagttttca
    2151  cctcgcgttt gggatcagcc cggatcagca agttgctatg gaaaatgcat
    2201  attcggagtt ggagcttgta ttcgaattcg ccccatttag aaacgaaatc
    2251  aacgtttttg aatggacaat caaccaccca gtcgtgatct gagcgtagac
    2301  cgcacccaaa agcgtggcaa acgaaagaac aacctagacg tcgcacactc
    2351  tggagttgcc aaatcggcat ctgcttctct tgttggcgct agttttgtta
    2401  cagttgctga aactgccagc tttgtggtca ctctcaattt ttgaagttga
    2451  tttgaggttg gcgcctccga atcttctcgt cgcaatcgtc ctgtgcatct
    2501  tcttttcttc tgtgctttct aacggcaatt cggtttctta ctactaccag
    2551  gctaatagta ctagcgataa gtttataact gtctctgtag gaaatggcag
    2601  cagcggatag tccgcaggtt attcaagctg cgtctgctgg ggcccaatgg
    2651  gccatcaagc tgcgggctaa aggctggagg agcttaacca agcttcagaa
    2701  agctcaagct cgcacccacg gggtcggtcc tgtgaccccc gccaccatcg
    2751  tgcctaaagt caccaggctt gtcaatggca atccggggaa cgttcgtcgt
    2801  cggaatggtg agcccggcaa cgctatgaaa agcatgacta tcacgaagca
    2851  agagtacctc ggcaccatct cagctggagg tggtgtcaag accttcatcc
    2901  tcgatccgcg caacgtgagg agcttccctc agttgagcgc attctgtttg
    2951  gggtacaaca agtacaagtt cacgaaactt gctttcaggt acagtcctcg
    3001  agtcaacgat accaccgcag gcatcatctg tgcctacact agtgactctt
    3051  ctgatgaggc cccccgaagc aagtaccaga tgtacagcat caatcccaga
    3101  tacgaggccg tagccagcaa acctctcatc gtctccatcc ctccgactaa
    3151  ggaaccgaag tttcttcggg acaagtcttc tgatgacgcc aaacttgtcg
    3201  acagtggttc aatccactgt ttgattgatg gtgatcatga gggaaagctt
    3251  ggagaaatct ttctcgatct gaccgtggtt ctctctgagc ccacgttcaa
    3301  ccagtgctcg atgcaagagg tcaccaaaac gaggcacatc aaaggaccag
    3351  ggtacgtcca accctcattc caagacgggg tggttacact gacgtttcag
    3401  gcgtcagggt cctacctctg tacatactcc tgtgccccga tcacatcgct
    3451  gagccaaacc ggcatggaag aagctgctag agtcacgacc acgtctacag
    3501  aggaaagtag cgggtttgtt gaggtggtga cagaagaacc cctcagttct
    3551  gttaagttcc agttcttaaa tcctgcgtcg agcaaattcc acgcgtatgt
    3601  tactagaatg tgagttgctg gagtcagacc ctggtgcgcc aacacccaga
    3651  agggggtcaa ccaacttgct tttagttact gcgtgcggtc tttcctctat
    3701  gataagcgtg ggcattaata atactcatga ataacccagt ctcgcatgat
    3751  ggagtgaaat cttttcaccc cgtcaaacgg gccagggtta ttctgagtgt
    3801  tacgatgcca tagtatctac tttgtagtta gtgcgtgtcg tcagacattg
    3851  taaatatgtc gtgtcgaggt caccaggcaa aatccttcgg gtgggcgtcc
    3901  tggggtctca aacctccttc ctggagggtg ttctaaagaa ggggaagttt
    3951  aacccacttc ccccttcgcc c