Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain Rolandia clone 1 p23 (p23) gene, complete cds.

ACC No: KC202886

Dated: 2013-01-28 | Length: 633 | CRC: -1589059347

                
ID   KC202886; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   KC202886;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain Rolandia clone 1 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (01-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="Rolandia"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .630
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /protein_id="AGC54943.1"
FT                   /translation="MDSTSGQTFVSVNLSPESNTASTAVRTVSSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRAKIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKGKARAFSNAEMFAIDLVMYTKEKQLAVNLAAEREKTRLARRHPMRSPEETPEF
FT                   YKFGITAKAMLPNINAVDVGDNEDTSSEYPVSLSVSDGVLREHHFI"
XX
SQ   Sequence 633 BP; 193 A; 126 C; 155 G; 159 T; 0 other;

kc202886 Length: 633  28-JAN-2013  Type: N  Check: 969  ..

       1  atggatagta ctagcggaca aactttcgtt tctgtgaacc tttctcccga
      51  aagcaacaca gcaagtactg cagttagaac cgtaagttcg gaagctgatc
     101  gcttggaatt tttacgaaaa atgaacccct ttatcatcga cgctttggta
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcaaaaa taataggagt
     201  atgcgtagat tgtggtagaa aacacgataa ggggttgaag accgaacgta
     251  aatgtaaggt caataataca cagtctcaaa acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tctaaataaa ggaaaggcta gagccttttc
     351  taacgcagag atgtttgcaa tcgatttggt tatgtacacc aaggaaaagc
     401  agttggcggt taatttggcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccga tgcgttctcc ggaagaaact ccggaattct ataaattcgg
     501  tataactgct aaagcaatgt taccgaacat caacgctgtg gacgttggtg
     551  ataacgagga cacttcgtcg gagtacccag tgagtctgag tgtttctgac
     601  ggagttctcc gtgaacacca cttcatctga ttg