Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain Rolandia clone 5 coat protein (p25) gene, complete cds.

ACC No: KC202899

Dated: 2013-01-28 | Length: 672 | CRC: -1914434873

                
ID   KC202899; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC202899;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain Rolandia clone 5 coat protein (p25) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (13-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="Rolandia"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="5"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AGC54954.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNFHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDELWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 193 A; 128 C; 171 G; 180 T; 0 other;

kc202899 Length: 672  28-JAN-2013  Type: N  Check: 2925  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttcc
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacga
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga