Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain CS-1 clone 1 coat protein (p25) gene, complete cds.

ACC No: KC202902

Dated: 2013-01-28 | Length: 672 | CRC: 653718121

                
ID   KC202902; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC202902;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain CS-1 clone 1 coat protein (p25) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (26-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="CS-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AGC54955.1"
FT                   /translation="MDVETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTHLNAALNRDLCLTLKGKYPNLPDFNKDFHIALMLYRLTVNTSSLQSDDDTTGVT
FT                   DAREGVELELSDELWTNVVINSPGIGNRTNAPRVRGRTNDALYLAFCRQNRNLRYGGLP
FT                   LDAGIPSGYHYLCANFLTGAGLTDSECATFLQAEEQLLKKRGAEEVVFTNVRQLGKMNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 134 C; 168 G; 179 T; 0 other;

kc202902 Length: 672  28-JAN-2013  Type: N  Check: 4122  ..

       1  atggacgtcg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggcacc
     151  catctaaatg ctgctttgaa tagagatttg tgtcttacct tgaaagggaa
     201  gtatcccaac ttacctgact ttaataaaga ctttcacata gctctgatgt
     251  tgtatcgttt aacagttaat acttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cggacgctcg ggaaggtgtt gaactggagt tgtctgacga
     351  actttggaca aacgtcgtga ttaactctcc gggtattggt aaccggacta
     401  acgcccctcg agtcaggggg agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gcgttatggt ggacttccgt tagatgcagg
     501  aattccgtcc ggttatcact acctgtgtgc aaatttcttg accggagctg
     551  gcttgactga ttcagaatgt gcaacgttct tacaagccga agagcagtta
     601  ctaaagaagc gaggggctga agaggtcgta tttactaatg tcaggcagct
     651  tgggaaaatg aacacacgtt ga