Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain CS-1 clone 3 coat protein (p25) gene, complete cds.

ACC No: KC202904

Dated: 2013-01-28 | Length: 672 | CRC: 1904365898

                
ID   KC202904; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC202904;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain CS-1 clone 3 coat protein (p25) gene, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (26-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="CS-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="3"
FT                   /db_xref="taxon:12162"
FT   gene            1. .672
FT                   /gene="p25"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="AGC54956.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   HQLGTQQKAALNRDLFLTLKGKYPNLPDKDNDFHLAMMLYRLAVKSSSLQSDEDTTGVT
FT                   YTREGVEVDLTDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRHNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAXEQLLKNRGADEIVLTPVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 133 C; 163 G; 179 T; 1 other;

kc202904 Length: 672  28-JAN-2013  Type: N  Check: 1398  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgttgcag ctgagtcctc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcatca gttgggtacc
     151  caacagaaag ctgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgaca aagataatga ctttcaccta gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgaagatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggact tgactgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaca accgcaactt gagttatggc ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtact tacaagctan agaacaattg
     601  cttaaaaatc gaggggctga tgaaatcgta cttactcctg tcaggcagct
     651  tgggaaattt aacacacgtt ga