Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain CS-1 clone 3 minor coat protein (p27) gene, complete cds.

ACC No: KC202907

Dated: 2013-01-28 | Length: 738 | CRC: -862047837

                
ID   KC202907; SV 1; linear; genomic RNA; STD; VRL; 738 BP.
XX
AC   KC202907;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain CS-1 clone 3 minor coat protein (p27) gene,
DE   complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-738
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-738
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (26-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .738
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="CS-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="3"
FT                   /db_xref="taxon:12162"
FT   gene            4. .726
FT                   /gene="p27"
FT   CDS             4. .726
FT                   /codon_start=1
FT                   /gene="p27"
FT                   /product="minor coat protein"
FT                   /protein_id="AGC54951.1"
FT                   /translation="MAGHTILPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 738 BP; 227 A; 131 C; 166 G; 214 T; 0 other;

kc202907 Length: 738  28-JAN-2013  Type: N  Check: 4067  ..

       1  atcatggcag gtcatacaat acttcctaag actgatgata aagaaatgga
      51  tccggtgagt gccgctgtac ccggtaagta cccggatgtt attgaaaaat
     101  ttgtggcaaa taggtctgta gatgcgttaa tagaaggcgt tataagtaag
     151  ttggatacca attcgatata cgaagattcc actgaaaagt ttactggtga
     201  gtacttaaag tacgttatgg ttactatgga cactttctta ttagaaaact
     251  ataaaacgaa aacggaagat ctgttagttc acttagctat gatccaaaag
     301  aggttatgca ccatatccac gagtactaaa actaagttcc gcgataaggg
     351  ttgtattagt tacgtacaag gaggtttacg atacaagtta ttggataaag
     401  tggtttttcc ttttattata tcgaaattta ccgacaggga gactccgaat
     451  gctctacgta agtatgcttg cactttcgag gagttacact tatgtatggc
     501  tagattaaga cccgacctat acgagaataa aaggacgacc aaggctggga
     551  ctccacattt aaaaggttac ttatcagctg actttctttc gggttctctc
     601  ccagggtact ctgagcatga acgaggcatt attcttcgag cgtccgaatc
     651  tatgttagct agacgtcagg gttacgagga ggcaaccgag cttcttaacc
     701  tacgtgattt gggtaagtac ttatagaatc actagtga