Sequence of DPV Citrus tristeza virus

Citrus tristeza virus strain CS-1 clone 1 p23 (p23) gene, complete cds.

ACC No: KC202908

Dated: 2013-01-28 | Length: 642 | CRC: -652068068

                
ID   KC202908; SV 1; linear; genomic RNA; STD; VRL; 642 BP.
XX
AC   KC202908;
XX
DT   23-JAN-2013 (Rel. 115, Created)
DT   28-JAN-2013 (Rel. 115, Last updated, Version 2)
XX
DE   Citrus tristeza virus strain CS-1 clone 1 p23 (p23) gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-642
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   "Evaluation of the protective capacity offered by new mild Citrus tristeza
RT   virus (CTV) isolates selected for a preimmunization program";
RL   Unpublished.
XX
RN   [2]
RP   1-642
RA   Zanutto C.A., Corazza M.J., Nunes W.M.C., Muller G.W.;
RT   ;
RL   Submitted (26-NOV-2012) to the INSDC.
RL   Departamento de Agronomia, Universidade Estadual de Maringa, Av. Colombo,
RL   5790 - Bloco S09 Nba/Cti, Maringa, Parana 87020-390, Brazil
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .642
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /strain="CS-1"
FT                   /mol_type="genomic RNA"
FT                   /country="Brazil"
FT                   /collection_date="2009"
FT                   /clone="1"
FT                   /db_xref="taxon:12162"
FT   gene            1. .630
FT                   /gene="p23"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /gene="p23"
FT                   /product="p23"
FT                   /protein_id="AGC54946.1"
FT                   /translation="MDNTSGQTFISVNLSDESNTASTEVKTVSSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCSRKHDKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINVVDVGDNEDTSSEYPVSLSISGGVLREHHFI"
XX
SQ   Sequence 642 BP; 198 A; 123 C; 158 G; 163 T; 0 other;

kc202908 Length: 642  28-JAN-2013  Type: N  Check: 8926  ..

       1  atggataata ctagcggaca aactttcatt tccgtgaatc tttctgacga
      51  aagcaacacg gctagtactg aagttaaaac cgtaagttct gaagcggatc
     101  gcttggaatt tttgcggaaa atgaatccct ttgttatcga tgctttgata
     151  cggaaaacca gttatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtagtagaa aacacgataa ggggtcgagg actgaacgta
     251  agtgtaaggt caacaacaca cagtctcaga acgaggtggc gcatatgtta
     301  atgcacgatc ccgttaagta tttaagtaaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgtacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg aaaagacgag actggctcgt
     451  aaacacccaa tgcgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaagcaatgt taccggacat caacgtcgta gatgttggtg
     551  acaacgaaga tacttcgtcg gagtacccag taagtctgag tatttctggc
     601  ggagttctcc gtgaacacca cttcatctga agatctaatc ac