Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate HB-2 coat protein gene, complete cds.

ACC No: KC477191

Dated: 2013-05-15 | Length: 597 | CRC: -910596569

                
ID   KC477191; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   KC477191;
XX
DT   15-MAY-2013 (Rel. 116, Created)
DT   15-MAY-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate HB-2 coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-597
RA   Liu M., Li M., Qi H., Cheng Y.;
RT   "Occurrence of Grapevine Leafroll-Associated Viruses in China";
RL   Plant Dis. 0:0-0(2013).
XX
RN   [2]
RP   1-597
RA   Liu M., Li M., Qi H., Cheng Y.;
RT   ;
RL   Submitted (06-JAN-2013) to the INSDC.
RL   Department of Pomology, China Agricultural University, No. 2 Yuanmingyuan
RL   West Road, Haidian District, Beijing, Beijing 100193, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="grape; cultivar: Carmenere"
FT                   /isolate="HB-2"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2009"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AGG08784.1"
FT                   /translation="MELMSHSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSDVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLSADFLGTCPKLSELQ
FT                   QTRKMFASMYALKAEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 157 A; 124 C; 160 G; 156 T; 0 other;

kc477191 Length: 597  15-MAY-2013  Type: N  Check: 1172  ..

       1  atggagttga tgtcccacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaaact tttatctgct gaagttgtga
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgctgat tcagacgtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtgac agagggtgac cttaagaagg tgctcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgca ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaagtta ccccaactca
     401  acgccgcggc ggaattgggg atcccagctg aagattcgta cttatctgca
     451  gattttctgg gtacttgccc gaagctctct gaattgcagc aaactaggaa
     501  gatgttcgcg agtatgtacg ctctaaaagc tgaaggtgga gtggtaaata
     551  caccagtgag caatctgcgt cagttgggta gaagggaagt tatgtaa