Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate HB-3 coat protein gene, complete cds.

ACC No: KC477194

Dated: 2013-05-15 | Length: 597 | CRC: -1642394811

                
ID   KC477194; SV 1; linear; genomic RNA; STD; VRL; 597 BP.
XX
AC   KC477194;
XX
DT   15-MAY-2013 (Rel. 116, Created)
DT   15-MAY-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate HB-3 coat protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-597
RA   Liu M., Li M., Qi H., Cheng Y.;
RT   "Occurrence of Grapevine Leafroll-Associated Viruses in China";
RL   Plant Dis. 0:0-0(2013).
XX
RN   [2]
RP   1-597
RA   Liu M., Li M., Qi H., Cheng Y.;
RT   ;
RL   Submitted (06-JAN-2013) to the INSDC.
RL   Department of Pomology, China Agricultural University, No. 2 Yuanmingyuan
RL   West Road, Haidian District, Beijing, Beijing 100193, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .597
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="grape; cultivar: Cabernet Sauvignon"
FT                   /isolate="HB-3"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="Sep-2009"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .597
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="AGG08787.1"
FT                   /translation="MELMSDSNLSNLVITDASSLNGVDKKLLSAEVVKMLVQKGAPNEG
FT                   IEVVFGLLLYALAARTTSPKVQRADSEVIFSNSFGERNVVVTEGDLKKVLDGCAPLTRF
FT                   TNKLRTFGRTFTEAYVDFCIAYKHKLPQLNAAAELGIPAEDSYLAADFLGTCPKLSELQ
FT                   QSRKMFASMYALKTEGGVVNTPVSNLRQLGRREVM"
XX
SQ   Sequence 597 BP; 164 A; 120 C; 158 G; 155 T; 0 other;

kc477194 Length: 597  15-MAY-2013  Type: N  Check: 296  ..

       1  atggagttga tgtccgacag caaccttagc aacctggtga taaccgacgc
      51  ctctagtcta aatggtgtcg acaagaagct tttatctgct gaagttgtaa
     101  aaatgttggt gcagaaaggg gctcctaacg agggtataga agtggtgttc
     151  ggtctactcc tttacgcact cgcggcaaga accacgtctc ctaaggttca
     201  gcgcgcagat tcagaagtta tattttcaaa tagtttcgga gagaggaatg
     251  tggtagtaac agagggtgac cttaagaagg tactcgacgg gtgtgcgcct
     301  ctcactaggt tcactaataa acttagaacg ttcggtcgta ctttcactga
     351  ggcttacgtt gacttttgta tcgcgtataa gcacaaatta ccccaactca
     401  acgccgcggc ggaattgggg attccagctg aagattcgta cttagctgca
     451  gattttctgg gtacttgccc gaagctctct gaattacagc aaagtaggaa
     501  gatgttcgcg agtatgtacg ctctaaaaac tgaaggtgga gtggtaaata
     551  cgccagtgag caatctgcgt cagctaggta gaagggaagt tatgtaa