Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS674-T36, complete genome.

ACC No: KC517485

Dated: 2013-04-30 | Length: 19292 | CRC: -508242839

                
ID   KC517485; SV 1; linear; genomic RNA; STD; VRL; 19292 BP.
XX
AC   KC517485;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FS674-T36, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19292
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19292
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19292
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="FS674-T36"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: T36"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9476
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30059.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIVVLHYFGSVRITKV
FT                   IRDKSADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGLPVINASGVVRPR
FT                   SVAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPRGTRSRLHRRVVR
FT                   RADTAPVESPQDKPTRRNSRLGKTSHLPYMGEAALDDILRWIEEVNPHPSMVAIPVPIT
FT                   FGTMPATAWCSRSEAAVLRCRLDYHAAETDFSTQEKHVRYVYNDVSSATNRPRTVSPRK
FT                   CGSIFPSKSKLGVEVPSGRDFHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVLMSDGVNTARLDVVAPAYYAYAKSLGARVRFLWESSDLDDAKV
FT                   RDGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGTSAHVLIGQVQVSIPGSIVKPSRSAVRRRNR
FT                   RMRRDGFLGSSGSSSSAGESTHCSDCSSPRSLPSPSVLKPSLGRIPSIDRRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGSNFDELCHAVCTYVKRYNSRKSFYTRFESGRDYLVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENQYAAVMMDVGTSWVPKGYVPDVDVVKRRRSRNRR
FT                   FSLSHRAVDQSVPALQSSPVEVASVSSDKPSSSQKASSPSTSSSSSFNSTRSSDWVNVG
FT                   FSHRTTNKVREPRSAGHRRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSFLRILL
FT                   ARLSGYRPLSDEFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAF
FT                   DIGSGGLLGLDSYGFSESLKDGYCYIRHFAEVSLSMGRIFFRRDVNLGPFPYVFEVQHR
FT                   LERLYGKAALRYGVRGQYSAPRCFHCCYNDSPRPMASFNGYHKMGGEDNSLIITDTDRL
FT                   RAVGSAYEKVKRNIPDSLLVRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLT
FT                   RAYPEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVH
FT                   VCRPVYDVKDAHRRVVRHHQLSKVSLDQSDGVKQVGAVNTNSVCGNILGECYHASEAMV
FT                   MVQVYDVPLRELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPIADRV
FT                   VYCFNNSAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISE
FT                   TKRLRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAK
FT                   TFEWTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRL
FT                   AAFSGETSIFELVRFAISEKCRDLFLGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTIS
FT                   EYSELDVPIDLPGFGGIVDGNETRLMEDGVKSALLRKAVQAEAQLSLKRGNTSEIVPCD
FT                   DDDDSNGDDSRVSHDSDGGSSSGGSSGGLRAGAAPSLFRCLLRKLGGGLCLAKKVLELL
FT                   VKRVVESFSRLKRKTARLTSFANLLLARLSCGFFDDTVFSAVWEIAINLTRIVDGVVKT
FT                   KLGCFRNLFRLIPKLYAGCKDVVKDVSNAYRSVVLFSAEVLGKSYSKLCQFCLEIFDIG
FT                   LIEVSARNLGLETCVSIALAIFDVLITFPLGSVSFPVVCARVFGALAMEVGSNFLFKKV
FT                   FGKPETLGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEDDA
FT                   WVGYSKHEVSSLPIVTFCVKRLSYSLERCKEACVAFIVDSAKKILKSLTSEFNESIQNS
FT                   DLTSGAKSLYGHVSSILSTSSGVINKAGSAVATVKAVGSDISGRVKRMRPRFSLSRHFD
FT                   EQTSEYYSASDCSELDESLFSETPGLRGNGRCRDLFRIVSRRAVACCEYVTILLKRLAS
FT                   RAGEYSYSYVMDTLVKLYVATDDVVRRCRSFTFDCTDKASNFVTGFLSWRSLRSGAYSA
FT                   TPGLGGGSRGLTSFSHTGGFTRVIGALGNTLSVVFDEEFFRTLLHRLRTDVVVLLVEFL
FT                   KNLPVCLFSIYTFFECRGRIFPLREFLWGFCRFVWDVIEGLSINAYQYLSAVAEKVYRG
FT                   AFNRRFNEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEVSSSRSSDSPSFPPTY
FT                   GEIEELNDDSSDSALVIGVDNGTGRTIVDGETDSASGSDSDVSIPLDRDFEQIGGLGGN
FT                   GNVDVVRLGLKFVLKLLRNLFGARSFKVLYGLLLQTLFYGGSVNKFVSRLVFSLGTCLP
FT                   FELLRFACSARRLLKSLASFVYQTNLFSEVMVEHLFSVSRLLYDSRYFATVFSELERLN
FT                   FYLDYFLSLPKRYLFPNSRARSCARVPVPVIRTEGVAPVCERSLNDILDSLDSLKVSDL
FT                   KGKSTFVDDGESDSGSEHSGSSISFGSVNEEVLNAVNGDGVCEKAPLMKHVTALSRLEP
FT                   DPSGRKDIPVSRKTFVRGESSGVKSKVSMCDYLVTLNSSFGTVPDMYPVARDITYKKLT
FT                   NAMREFYYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGR
FT                   NGSHPFRNTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTF
FT                   TNEEHSLIVYEAPPGGGKTHSLVNCYADYCVKVSCLVVTANKNSQTEISQRISNELMGR
FT                   KLAAKYVTGAASRVFTVDSYLMNHLRLTTQLLFIDECFMVHAGAIGAVVEFTSCKAVVF
FT                   FGDSKQIHYIHRNDLGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICEWLSEFYPRHVAT
FT                   ANVGSIGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRNKVVPIV
FT                   NTVHEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTAT
FT                   NIDRAKEIFDKFRSSNHSYGSSSLEWYLEKYPTEYKGSKASSAPISCINEFLNEVVVGS
FT                   SVVQLGDVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVTA
FT                   RKPSVVRKS"
FT   CDS             <9349. .10851
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30060.1"
FT                   /translation="ETPPLLTRVTYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPSEFGRAMAAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIK
FT                   AVQAELKLPFSVEEQISNFKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTEMTNAGLAEIIRRIIGDDDNLFVGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFDLLLVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQNKLTDVELFELFTSFKDMTQDFGDQVVLEKLK
FT                   LLVEAKYGFTSGTTMPALCAIHCVRSNFLSFERLFPFIRGWYVVDALKLRQLRKLTNLI
FT                   CERVVYDNRVSYFSYFDNPFTKPDANDDNVDDLGQAGELATG"
FT   CDS             10900. .11811
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30061.1"
FT                   /translation="MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDR
FT                   DPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKT
FT                   FDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFFFRAVSETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLG
FT                   DSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYVAEYNENARSRVSLIRRVCC
FT                   YAVCVLVVSVLIMSGLLAIIFI"
FT   CDS             11885. .12040
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30062.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRSASPY
FT                   GTHATV"
FT   CDS             12046. .13830
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30063.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATPSELVILKQSNSSYIPTCLFLHAEPN
FT                   SVSYGYDAEYLAASGESGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVIVKEFGTKSVP
FT                   VPYLSPLNNDLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLNSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFVPQKELNVSSLKEALSLQTDPVKYTVNHYG
FT                   MSETVSIDQTVLREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDA
FT                   LATVPFVSGIVPVGDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWS
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSRYDYAGMPHPTRKLVRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13754. .15361
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30064.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLMSRGEDFADLTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSSVSGVTTKLETYLSYCMSLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDLRLAADNPD
FT                   LRVGLRWAGMFVYYGVYRCAVDRAVERPTLFRLPQKLLSQDEGESCSLHMSSVEALFNL
FT                   VQKVNKDINVRRQFMGRHSEVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRIPDG
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYSTS"
FT   CDS             15336. .16058
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30065.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLYTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKFACTFEELHL
FT                   CMARLRPDLYENKRTTRAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16152. .16823
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30066.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16789. .17292
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30067.1"
FT                   /translation="MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNLVTL
FT                   FSVT"
FT   CDS             17326. .17685
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30068.1"
FT                   /translation="MSFRRLWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFT
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17761. .18309
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30069.1"
FT                   /translation="MRAYFSVNDYISLLAKVSAVVERLCDPSVPLAEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELRLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18391. .19020
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30070.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTATTDVKPVSSEADRLDFLQKMNPII
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19021. .19292
XX
SQ   Sequence 19292 BP; 4688 A; 3852 C; 4870 G; 5882 T; 0 other;

kc517485 Length: 19292  30-APR-2013  Type: N  Check: 24  ..

       1  aatttctcaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gccatcgctg
     151  ttaacagcga ttacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttctgttaga atcaccaagg tgattcgtga
     251  caaatcggct gatatgccga tagtcccttt acggaaatct gtatttccgt
     301  tttctgttcg cgcggctgtc cgcgcaattc gtgctgctgg gcgtcctctt
     351  gacgctccgc attcagggtg cctctgtggc cttcccgtta tcaacgcatc
     401  tggcgttgtt cgtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc gctcacctct gccgctaaga ggtccctccg ccaggcaaag
     501  cgggaatctg tttccctttc tagccgggcc tcttctcgct tctctaggga
     551  agtccctcgc ggcacacgtt caagacttca tagacgtgtg gtgagacgag
     601  ctgacactgc cccagttgag agtccccaag acaagcctac ccgacgaaac
     651  agccgacttg gtaagacttc tcacctccct tacatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga tcgaagaggt taatcctcat ccctcgatgg
     751  tcgctattcc agtgcccatc acttttggaa ccatgcctgc aacggcttgg
     801  tgttcccgtt ctgaagccgc agttttgcgg tgccgccttg actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acacgtacgg tacgtctata
     901  atgacgtatc ttctgccact aaccgtcccc gtacggtttc tccccgcaag
     951  tgcgggtcca tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac tttcacactg cgttcgtgag atcttctcac gccagcgctt
    1051  tcttctctga cgcggttcgc cgcgttcgtt tgttccgtcc agcgcggaac
    1101  aattttttca cttccgtcgt cagcggacga cgtgtttgct attacagacc
    1151  cggtccgtgt ggtacggtgt ctgttttaat gtcggacggt gttaacacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taaatctttg
    1251  ggcgccagag tgcgcttttt gtgggagtcg tccgacttgg acgacgctaa
    1301  agttcgtgac ggtcaatgtt atgtccgtca tgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ctttccgtgc gtagagcact gggtatgtac
    1401  cccacagtgg gtgcactaaa ggcttatctt gttcgcgaat acggtcgcga
    1451  ctctcttaag gttcctatgc gtgggaccta cacttttggc agtgtgtttc
    1501  actgcttgtc gactaaatct tcagtcgacc tgcgatctat tcctaaccat
    1551  catttagttg gtgggacgtc tgcccacgtc ttaattgggc aggttcaagt
    1601  cagtattcct ggctcgattg ttaaaccttc acgttcggcc gttcgtaggc
    1651  gtaatagacg catgcgacgt gatggttttc tcggtagttc cggttcttct
    1701  tcttctgcgg gggagtcgac tcactgttcg gactgctctt ctcctcgcag
    1751  tttaccatct ccttccgttt taaaaccttc cctaggtcgg atcccgagta
    1801  tagatcggcg gttccggttt cctgcgggta cgcagttgcg cgtctccgta
    1851  cctaggcggg tcgatgacca tgtttacgtg tcgactggta gcaacttcga
    1901  tgagttgtgc catgcagttt gcacgtatgt caaaaggtac aactctagga
    1951  aatcctttta cactcgattc gagagcggaa gggactactt ggttttgcgg
    2001  cgtgcttccg ttgggggtct tcacgtgttt gtaaagcgtg gcaactttac
    2051  tgcccgattt cctatttcgg cggtcaggta tgagaatcag tatgccgcgg
    2101  ttatgatgga tgtggggact agttgggttc cgaagggcta cgttcccgat
    2151  gttgatgttg tgaaacgtcg gagaagtcgt aatcgtcgtt tttctctttc
    2201  ccatcgcgcg gtggatcagt cggtccccgc gttacagtcg agtcctgtcg
    2251  aggttgcttc ggtttcgagt gataagcctt catcgtcgca gaaggcttct
    2301  tcaccttcta cttcttcttc ttcttctttt aactcgacaa ggagttcaga
    2351  ctgggtgaat gtcggtttct ctcatcgaac tactaataag gttcgtgaac
    2401  cgcgttctgc tggtcatcgt aggatcggaa attttacttt cccgaggggc
    2451  acagtgtaca acacgcctgt cgatgagcgc gcctataaac gtgttcttag
    2501  attgcgagat accacagcct gttcctttct ccgtatactg ctagctcgtt
    2551  tgtcgggtta cagaccttta agtgacgagt tctttaacaa gtgtgtcact
    2601  tcccggtttg tcgcgtgcat tgaacctgtg gaatcaggtc tcgttaaggt
    2651  gcattttcgt tctgatgttt tccgtgcctc tttcccgttt ggggtcaacc
    2701  tatacacccg ccacgcgttt gacattggaa gtggtggtct cttgggattg
    2751  gatagttacg gcttttcaga atccttgaag gatggatatt gctacattcg
    2801  ccatttcgcc gaagttagtt tgagcatggg gcgaattttc ttcaggaggg
    2851  acgtcaactt gggacctttc ccatacgttt tcgaagtgca acaccgtctt
    2901  gaaaggttgt acgggaaagc tgcgttaaga tacggtgtta ggggtcaata
    2951  ttcagccccg cgctgttttc actgttgcta caacgattca ccgagaccga
    3001  tggcgtcctt taatgggtac cataagatgg gtggtgaaga taactccctg
    3051  ataatcacag acaccgacag gttgcgtgct gtggggagtg cctatgaaaa
    3101  agtgaagaga aacataccag attcgttatt ggttcggtct gtagaaaagg
    3151  accttataga gtttaatcag actctagtcg acatgcatcg atccagaccg
    3201  ggcgttgtcg tacctttcca aatgagtgag aatcagcaag tgatgcttac
    3251  tagggcgtac ccggaattta atattaattt tattcattcc gtacattccg
    3301  atcatccggt ggccgcaggt tctagggcgt tggagaatca tctcgttcgt
    3351  aaacacgctg gtaccgatta ttcggatgtg gggggttgtc cgctgtttca
    3401  tttacgtgcg ggtcactccg gcgttcacgt ttgtagaccg gtgtacgatg
    3451  ttaaagacgc tcatcgtaga gtagtccgtc atcaccaact tagtaaggtt
    3501  tcgctagatc agagtgacgg tgttaaacaa gttggtgctg taaacacgaa
    3551  ttctgtatgc ggtaacattt tgggagagtg ttatcatgca tcggaggcga
    3601  tggttatggt tcaagtttat gacgtaccgc tacgtgagtt gtgtagggct
    3651  atgataaaca agaaaacttc cgtgtgttat atgaccatgg ttacacctgg
    3701  tgagttgttg gacgcccgcg agtccttttt tattaaggac ttggattgtt
    3751  cggttgagtt agatcccatt gcagacaggg ttgtttactg tttcaacaat
    3801  tctgcgtata cacacacgta ctccactata tgtgagtata tgcgaactcc
    3851  ttgcttggta gtggacgggt ttttgtttac tatcgaaatg gtatcgctca
    3901  ggtgtagcgt taattactat tgtatcacca agtcgtcggt ctgtccgaga
    3951  attagtgaga ctaagcggtt gcgctaccgt cggtgtgata gcgacttgat
    4001  tagaatcaaa attccccggt actccagtaa gactcgtagt tgtttacctg
    4051  ggtgttacta tttgtacttg gacgccaagt ttgtaagtcg cgtgtacgag
    4101  tacgtggtca ataactgcgt tgtggtgaac gcgaaaactt ttgagtggac
    4151  ttggaattac atcaaatctt gcaagtcgag agtggtgatc agcgggaaga
    4201  ttatacaccg agacgttcca atcgctttag agtacttaga tgggttttct
    4251  gcggttatgc tgtccgctgg tgtgaagggt aggcaaaacg cggaagcgtt
    4301  ttctagacgc ttagccgctt tttcgggtga aacttcgatt ttcgagttag
    4351  tgaggtttgc tatatccgag aagtgccgcg acttgttctt gggtattcag
    4401  gatgctgtgg aaagatgcgt gaagtcgtac ctcaggaatt cgtttaatat
    4451  gagtttcgtg gacttgtccg accccttact tacgattagc gaatattcag
    4501  aattggacgt tcctatcgac ttaccgggtt ttggtggaat agtggacggt
    4551  aacgaaacta gacttatgga agacggtgtt aaatcggctt tattgcgtaa
    4601  agcggttcaa gccgaggctc agttgagtct taagagaggc aatacttccg
    4651  aaatcgttcc gtgtgatgac gatgacgact caaacggtga tgattcgcgt
    4701  gtttcgcacg attcggatgg tggttcgtct tcgggcggta gttctggcgg
    4751  gttgcgagct ggagccgccc cttctttgtt taggtgttta ctcaggaaat
    4801  tgggtggggg tttatgtttg gcaaagaaag tgttggaact gttagtcaag
    4851  cgggtggttg aatcgttttc tcgtttgaag cggaaaaccg ctcgtttaac
    4901  gtccttcgct aatttgttgc ttgcgaggct ctcttgcggg tttttcgatg
    4951  acactgtttt ttctgcggtc tgggaaatag cgatcaacct gaccaggatc
    5001  gtcgatggag tagtcaagac aaaactgggg tgctttcgta atttatttcg
    5051  attgattccc aagttatacg ctggttgtaa ggacgttgtg aaggacgtta
    5101  gtaacgctta caggtcggtt gtcttgtttt ccgctgaggt tttgggtaag
    5151  agttactcta aactttgtca gttttgcttg gaaatatttg acatcgggct
    5201  tattgaggtt tctgctcgta atttgggact ggaaacatgc gtttcaatag
    5251  cactggctat ttttgatgtg ttgattactt ttcctttggg gagcgttagt
    5301  tttcccgtcg tttgcgctag ggttttcggt gctctcgcta tggaagtggg
    5351  atcgaacttt ttgtttaaga aagttttcgg taaacccgaa actcttggtg
    5401  aagatgcttt ccgtaggact gtgagtatgg ttttgagcgc caaagcgttt
    5451  gacaagcttt ccgtggatgc gaaaggttta gttaggtgct ctggtgttat
    5501  tcctggagtg ttaaggataa tactatcttc cttgttttcc gaagatgacg
    5551  cttgggtggg ttatagtaaa catgaagttt cttcccttcc tattgttacc
    5601  ttttgtgtga agagattgtc ttattctctg gagcggtgta aggaagcgtg
    5651  tgtcgcattt attgttgact ctgctaagaa gattttgaaa tctttaactt
    5701  cagagttcaa cgaatccatt caaaactccg acttgaccag tggtgctaag
    5751  tccttgtacg ggcacgtgag ctcgatactt tccacctcta gtggtgtgat
    5801  taataaagca ggaagcgccg tcgctactgt taaagcggtc gggagtgata
    5851  tcagtggtcg tgtgaaacgt atgcgacccc gattttctct gtcccgtcac
    5901  tttgacgagc agactagtga gtactactct gctagcgatt gttccgaact
    5951  agatgagtcg ttgtttagtg aaacgcctgg tcttcgtgga aacgggaggt
    6001  gtagagattt gtttcgtatc gtgtctagac gcgcggtagc gtgttgtgag
    6051  tacgtgacaa ttcttttgaa acggctagcg tcgcgtgccg gtgaatactc
    6101  ctactcgtat gtgatggata cgctcgtgaa attgtatgtg gcgaccgatg
    6151  atgttgttag acggtgcagg tcctttacgt tcgactgtac tgataaagca
    6201  tctaatttcg tcaccgggtt tctcagttgg cgcagcttac gttctggtgc
    6251  gtattctgca actccagggt tgggtggtgg tagtagaggt ttaacgtcgt
    6301  tttctcacac cggtggattc acgcgcgtta tcggcgctct tgggaacacc
    6351  ttatcagtgg tgtttgatga ggaattcttc agaactttgc tgcatcggtt
    6401  gaggacagat gttgtggttt tactggtgga gttcttgaaa aaccttcccg
    6451  tttgtttgtt ttcaatatac actttttttg aatgtcgggg taggatcttt
    6501  cctttaagag agttcctatg gggtttttgt cgtttcgttt gggacgttat
    6551  cgaggggttg tccatcaatg cttatcaata cctctctgct gtcgctgaga
    6601  aagtgtatcg aggtgccttt aatcgtcgat ttaacgaaga ggatgagagg
    6651  acgcttcgag tgatcacgga agcagaggga agaatcgaat ttttgcgagt
    6701  tgttctcgcg gaaatggaaa ggttccgtgc tgcgtcgaac gaggtttctt
    6751  cgtcgaggtc gtctgatagt ccttcattcc cacctactta cggtgaaatt
    6801  gaggagttaa atgatgattc ctccgatagt gcgctagtga taggcgtcga
    6851  caacggtacc ggccgcacta tcgttgacgg tgagaccgat tctgcgtccg
    6901  gtagcgatag tgacgtttct atcccgttgg atcgcgattt tgaacaaatc
    6951  gggggtcttg gtggaaatgg taacgtcgat gtcgttcggc tgggtttgaa
    7001  attcgttctg aagttgttac gcaacctatt cggtgctaga agttttaaag
    7051  tgttgtatgg gttgttactt caaacccttt tttatggtgg ttcggtaaat
    7101  aaatttgtgt ctcgtctggt ctttagtctt gggacttgct tacctttcga
    7151  gttactccga tttgcgtgtt cagcgaggcg gttgttgaag agtttggcat
    7201  catttgttta ccagactaac cttttcagcg aagttatggt ggagcatttg
    7251  tttagcgttt cccgactgct ttatgattcc cggtacttcg cgactgtgtt
    7301  ttcggaattg gagagactta acttctattt agactatttc ctttcgctcc
    7351  cgaagagata tctattccct aattctaggg ctcgtagttg tgctagggtt
    7401  ccggttcccg tgattaggac cgaaggagtg gcaccagtct gtgagagatc
    7451  actaaatgac atattggact ctttagactc tttaaaggtg tcggacctca
    7501  aagggaagtc gacgttcgtt gatgatgggg agtcggattc cggtagtgaa
    7551  cattcgggta gttcgatttc gttcggttcc gtcaacgaag aagttttaaa
    7601  tgcggtaaat ggtgacggcg tttgcgaaaa agccccgttg atgaagcatg
    7651  ttaccgcact tagcaggttg gaacccgacc ctagtggtcg taaagacatt
    7701  cctgtttcta ggaaaacttt tgtgcgtggt gaatcttcgg gtgtgaaatc
    7751  gaaggtgagt atgtgcgatt acttggtgac cttgaattct tcgtttggca
    7801  cagtgcctga catgtaccct gttgcgcgtg acataacgta taagaaactg
    7851  actaacgcca tgcgcgaatt ctattactcg caaaaaataa ccttgtacga
    7901  acttcacggg aagttgagtt cctattggga cgagttgaag gtcgcaggtt
    7951  tcgatagaaa gttaacgaga atggatttgg acgatgatgt ctatgttgtt
    8001  gactttaatc ggaaattgtt ggtggggaga aacggatctc atccgtttcg
    8051  taatacgtta aagtcctatt gttttatgtt ttgtaacgat gggttggttc
    8101  cttgcccggg ttctcagaaa tatgattatg ctttgatttc taatcaaacg
    8151  tcttttgttg ccgcgaattc gttcttacgt gccgtggatg gtaaggattt
    8201  gacttttacc aatgaggaac atagccttat cgtttatgaa gctcctcccg
    8251  gtggtggtaa gactcattct ttggtgaatt gctacgcgga ttattgcgtt
    8301  aaagtatctt gtttagtagt gaccgctaac aagaattctc aaaccgagat
    8351  atctcagcgt atatctaatg aattgatggg caggaagcta gctgctaagt
    8401  atgttaccgg tgcagcttcc agagtgttca ctgtggattc ttacttaatg
    8451  aatcacttgc gacttacgac tcaactgctg tttatcgacg agtgctttat
    8501  ggttcatgct ggggcaattg gagccgtggt tgagttcacg tcttgtaaag
    8551  cggtggtttt ctttggtgat agtaagcaaa tccattacat tcaccgaaac
    8601  gatctcgggg tttctttgtt gcatgatatt gatgcgttta ttcaaccgga
    8651  acatcgtatt tacggcgaag tgtcctatag atgtccttgg gacatttgcg
    8701  agtggctttc cgagttttac ccgcgacacg tagctactgc taatgtaggg
    8751  agtattggga agtcgagtgt gtcaatagag gaaatcaatg ggtgcgatga
    8801  cgtaccttac gacaaggcgg cgaagtacat tgtgtacact caggctgaaa
    8851  agaacgattt gcaaaaacac ctcggtcgct taaccgtggg tcggaacaag
    8901  gtagtaccaa ttgtaaatac cgttcatgag gtacaaggag agacctataa
    8951  aagggtacgt ctggtgaggt ttaagtatca ggaggatacc ccgttctctt
    9001  caaagaatca tattgtggtt gctttgacta gacatgttga ttctttggtt
    9051  tattccgtac ttactagtag gaggtacgac gatactgcga ctaacataga
    9101  tagggcgaag gaaatttttg acaaatttcg ttcgtcgaat cactcgtacg
    9151  gttcgtcatc gttagagtgg taccttgaaa aatatcctac cgaatataag
    9201  ggtagtaaag catcctctgc tccgataagt tgcattaacg aattccttaa
    9251  tgaggtcgtc gttggttctt ctgtcgtgca gttgggtgat gtgtctgaag
    9301  aactaagttc acgtcccttt gaatcgggtt gtgataatgt tactgtaaga
    9351  gacaccgccc ctcctgactc gggtaactta cacgaaccgg ctcgcgttcg
    9401  gcgtagtaag gtcacaagca attcctccaa gaaaagcgtc actgcaagaa
    9451  aaccttctgt cgtacgaaag tcgtaattac aactttatca agacggaacg
    9501  gtttgttgga ccaagcgaat ttggtagggc gatggctgct gctgttatcg
    9551  aacgttgttt caaaatggaa gagatggcta agataaggtg tgatattata
    9601  tcccttactg aagctaacat tttaaaatgg ctcgataagc gaactccctg
    9651  tcaaataaag gccgtacagg cggagttgaa acttcccttt tcggtggagg
    9701  agcaaatttc caacttcaaa ctgatggtta aacgtgatgc taaggtaaaa
    9751  cttgacgatt caagtctatc taaacatccc gctgctcaga acatcatgtt
    9801  tcataagaag tttatcaatg ccatattttc cccgtgtttc gacgagttca
    9851  aaaatagagt gttgtcctcg cttaatgaca atatcgtgtt ctttactgag
    9901  atgacgaacg ctgggttagc ggaaattatc agaagaatca ttggtgacga
    9951  cgacaactta tttgttgggg aagtggattt cagtaagttc gataagtctc
   10001  aggatttgtt cattaaagag tacgaacgta cgttgtattc cgagtttggg
   10051  ttcgataccg aacttctcga tgtgtggatg gaaggtgagt atcgcgctag
   10101  agccaccacg ctggatggtc agctgagttt ttcagttgat ggtcagcgtc
   10151  gttctggagg ttcaaacact tggattggga attccttggt tactctaggt
   10201  atcctttcgt tatattacga cgtttcgaag tttgacttac tcctcgtttc
   10251  tggagacgat tctttaattt attcgagtga aaagataagc aacttttctt
   10301  ccgaaatttg cttagaaaca ggttttgaga ctaagtttat gtctccgagc
   10351  gtgccatatt tttgctcaaa gtttgtggtt cagaccggta acaaaacgtg
   10401  ttttgtgcct gacccttata aattattagt aaagttgggg gctccacaaa
   10451  ataagttaac cgatgtcgag ttatttgagt tgttcacttc ttttaaggac
   10501  atgacgcagg actttggtga tcaagtggtt ttggagaagc tgaagttgct
   10551  agtcgaagct aagtacggtt tcactagtgg gaccactatg ccagcattgt
   10601  gcgctattca ttgtgtgcga tcgaactttc tgtcctttga gaggttattt
   10651  cctttcatta ggggttggta tgttgttgac gctctaaaac tcagacagct
   10701  taggaaactc actaatttga tctgtgaacg tgtagtttac gacaatcggg
   10751  tgagttattt ttcgtacttc gataacccgt tcactaaacc tgacgctaac
   10801  gacgataacg tggacgacct cggacaagcg ggtgaattag caaccggctg
   10851  atcgattgat tagttctcgc tgagagctaa tgtgggtagt tgagtcggga
   10901  tgtttgcctt cgcgagcgaa agccaagact tgttagaaga aaaagttttt
   10951  cgtcgtagaa cttaccatcg taaatatttc ggtgacgtgg ttaaggactt
   11001  cactatcgat attggttatg atactaccga tcgcgatcct actgtattgg
   11051  ccgattattt ctcattgtat ttctttttac ttaacaacga tagtgttggg
   11101  cctatagcag cttcaattgt ggtaagccca ccggttagcg ggactcataa
   11151  aattcgagcg catatcgata atcaaccgaa ctgtgaaggt aacgtgactt
   11201  acgttaaaac cttcgacaaa agtcgctttg tgattcgcgt aaaagcggtc
   11251  cccgcttcta tgagaggtta ctactctttt cgggtgtttc ttagtagcga
   11301  tgttgctagc gaacgcagcg agttcgtgtg cagttttgtt ggtagcaggt
   11351  ttctttgctg ttgtacacaa acgatatctg aaaatttgag taaagtttgt
   11401  tcatcttcct tcttcttcag agcagtttca gaaaccgcga ccaacgaatt
   11451  ttctgttgcg actgatgatg tggaagacgt taagtacata agaaaacaag
   11501  ccgagggttt ttcacgttgc gctgacccat accctcctag gtgttatcgt
   11551  agcactaatt tgggcgattc ttcaggggtt cagagtcgta cgattgaaga
   11601  ggaaggttat atgacgggca ctgcaggtaa cgtcgcagtc accgtcccga
   11651  atactccact agttagtgct gtctctccgt atgtcgcaga gtacaacgag
   11701  aatgcacgct cgcgcgtctc attaatacgc cgggtctgtt gttacgccgt
   11751  ttgtgtttta gtggtgtccg ttcttataat gagcggttta ttagccatta
   11801  tatttatatg atttggtgta gtaactcata aggtacaatc acttacttaa
   11851  gactcgccgt ttgactctgt ttaaacgggg tttaatggac tgcgtaattc
   11901  aagggttttt aactttccta gttggtatag ctgtgttttc tgcttttgcc
   11951  ggactgatta tcattgttat aacaatttat cggtgcacga ctaagcccgt
   12001  cagaagcgct tccccttacg gcactcacgc gactgtctaa gcggtatggt
   12051  gcttttgggt ttagacttcg gtaccacgtt ttcaacggtg gctatggcta
   12101  caccttcaga gttagttata ctcaaacaat ccaattcatc gtacatacct
   12151  acgtgtttat tcctgcatgc ggaacctaac agcgtatctt atggttacga
   12201  tgcggaatat ttagcggctt ctggggagtc tggttcgttt tacaaagatt
   12251  tgaagcggtg ggttggttgc actgcgaaga actaccaaac ctacttacac
   12301  aaactatcac cttcctataa ggtgatagtg aaagagtttg gaactaagag
   12351  cgtgccggtg ccatatttgt cacctctgaa taacgattta ggactcagcg
   12401  tcgctttacc ttcactgatc gcttcgtatg ccaaatccat tctgtcggat
   12451  gcggaacgag tgttcaatgt aagctgcact ggagttatat gttcggtacc
   12501  tgctggttat aacacgttac aacgagcttt tacacagcag agcatatcga
   12551  tgtcgggtta ctcttgtgtg tacattatta acgaaccttc agcagccgcg
   12601  tactccactt tacctaagtt gaattcggca gataagtatt tagccgttta
   12651  cgacttcggc ggtgggactt ttgatgtctc tatagttagc gttagattac
   12701  ccactttcgc cgttagaagt tcgggcggtg acatgaattt aggcggtaga
   12751  gatatcgaca aaaagttatc cgataaaata tacgaaatgg ctgattttgt
   12801  gccgcaaaaa gaattgaacg tttctagttt aaaggaagct ttatctcttc
   12851  aaaccgatcc ggtcaaatat actgtgaatc attacggaat gagtgagacc
   12901  gtatcaattg atcaaacggt gttgagggag atagcctcgg tgttcataaa
   12951  tcgaacgata gatatactta cgcaagttaa ggttaagtct agtatgcccg
   13001  aatcgcaaag tttgaagtta gtggtagtcg gtggaagctc gtacctacca
   13051  gggttgttgg acgctttggc aaccgtgcct tttgtgtctg ggatagtgcc
   13101  ggtgggagac gcaagaaccg ctgtcgccag agggtgcgct ttgtatagcg
   13151  agtgcttaga tggtaggtct aaggccctac taatagattg tattacgcat
   13201  catttgtcgg tcacgacgtt tagcgcggat tcggtcgttg ttgcagcggc
   13251  cggtagtcca attccttttg aaggtgaacg aaaactcacg ttacgcaaat
   13301  gcgttagtac gtctaactat caagcaagaa tgttcgaagg ggattacgaa
   13351  aaagttttcc gaaatgaacg tatatacgca gcttcggtat cattgtttac
   13401  attaggagtt aattggagtg tgcctaacga cgttgagatg actctcgtga
   13451  ccaaagtgga ctcgatgggt aaagtggaat tttaccttaa aggtccatct
   13501  ggtgaactgg ttaacgtgca aggtacttcg cgttacgatt atgctggtat
   13551  gcctcacccc actagaaagc tggtgaggct tagcgattac aatgtaaact
   13601  ccgccgcttt agttttagct ttgacattaa ctcgcgaaaa acgagaaaag
   13651  ttccttttgc gaacattatt tgacacttta ctagcggatt tacgaaagac
   13701  agcaagttta agcgagtact caaagaagta cccgatcact cgaaacgata
   13751  tcgatgtcgt ctcatcacgt atggggatcg ttgtttcgaa agttttacgg
   13801  ggaagcgatt tggaaagaat acctctctga atcaactcga aatttcgatg
   13851  aaagaaatgt atcgttagac cacactttga gttcgggtgt ggtcgtccgt
   13901  aggcagagtc ttttgaatgc gcctcaaggg actttcgaga acgagttagc
   13951  gctattgtac aattcggtgg tgattaacga ttttgttgag ttgactggta
   14001  tgcccttgaa gtctttgatg acaggtatcg aagaccgtaa ggtacctgac
   14051  gaattaatat ccgttgaccc gcacgaagtc ggatgtagat tcacgttaaa
   14101  cgacgtggaa tcgtatctaa tgagcagggg tgaggatttc gctgatctaa
   14151  cggcggtcga gcattcgtgg tgtttgagca actcttgtgg tagactatta
   14201  agttcgactg agatagatgc ttacaaaacc ttggtgttta ctaagaattt
   14251  tgatagtagt gtatccggag tgactactaa gttagagact tatctatcgt
   14301  actgcatgtc attgtacaag aaacattgca tgaaagacga tgattatttt
   14351  aatcttatct tacctatgtt taattgttta atgaaagtgc tggcgtcgct
   14401  tggtttgttt tatgagaaac ataccgacaa tccgctactg accggaatgc
   14451  tcatagagtt ttgcctagaa aataaggtgt attactctac ttttaaagtg
   14501  aatttagaca acgtcagatt gtttaagtct aaagtgttgc ctgtggtgtt
   14551  aacggtttgg gatatatccg agcctgatga cccagtggat gaaagggtgc
   14601  tgattccttt cgaccctacg gatttcgtgc tcgatttacc taaattgaat
   14651  atacacgata caatggtggt ggtgggtaat caaatcagac agttagaata
   14701  cgtagtcgaa agcgatgctt tagacgatct atctcaacac gttgatttac
   14751  gtttagcagc ggacaatccc gatctacgcg ttggtctgcg ttgggcaggg
   14801  atgtttgtgt actacggtgt ttatcggtgt gctgttgata gagcggtgga
   14851  acgaccgacg ttgtttagat tgccgcagaa actattgagt caggatgaag
   14901  gcgaatcgtg ctcattacac atgagttccg tcgaagcttt attcaatctg
   14951  gtgcagaaag tgaacaagga cataaacgtt agacgtcagt tcatgggacg
   15001  tcatagtgaa gtggctttgc gactgtatcg caacttaggt ttgaggtttc
   15051  caccgatctc atcggttagg ttaccggctc atcacggtta tttatacgtc
   15101  gatttttaca aaagaatacc tgacggtgct gttaccgccg acgaactcga
   15151  aagtttacgt caattacgct catccgtgga cgttatgtgt aaggacaggg
   15201  tgtcaatcac acctccacca ttcaatcgac ttagaagagg ttcttctaga
   15251  acatttagag gtcgaggcgc acgcggtgcg agctcgcgtc atatgagcag
   15301  agacgtggcg acttccgggt ttaatttacc ttatcatggc aggttataca
   15351  gtacttccta aaaccgatga caaagaaatg gatcctgtga gtgccgccgt
   15401  gcccggtaag tatccggatg tcattgaaaa gtttgtggcc aataggtccg
   15451  tagatgcgtt aatagaaggc gttataagta aattggatac caattcaata
   15501  tacgaagatt ccactgaaaa gtttactggt gaacacttga aatacgttat
   15551  ggttactatg gacactttct tattagaaaa ctacaaaacg aaaacggaag
   15601  atctgttggt tcacttaact atgatccaaa agaggttata cactatatcc
   15651  acgagcacta aaaccaagtt tcgcgataaa ggttgtatta gttacgtaca
   15701  agggggttta cgatataagt tgttggacaa agtagttttt cctttcatta
   15751  tatcgaaatt taccgacagg gagactccaa acgctctacg taagtttgct
   15801  tgcactttcg aggagttaca cttgtgtatg gctaggttaa gacccgactt
   15851  atacgaaaat aaaaggacga ccagggctgg gactccacat ttaaagggct
   15901  acctatcagc tgactttctc tcaggttctc tccctgggta ctccgaacat
   15951  gaacgaggta tcattcttcg agcgtccgag tctatgttag ctagacgtca
   16001  aggttacgag gaggcgaccg agcttcttaa cctacgcgat ttgggtaagt
   16051  acttgtagtt ggtttgggga cggtaacatt atactatccc atgagcgctg
   16101  ctttaagggt cgttaattga cgactcttga tatatttact aggtttgaat
   16151  tatggacgac gaaacaaaga aattgaagaa caaaaacaag gaaacaaaag
   16201  aaggcgacga tgttgttgct gccgagtctt ctttcagttc cgtaaactta
   16251  cacatcgatc cgactttgat aacgatgaac gatgtgcgtc agttgagtac
   16301  ccaacagaac gctgctttga acagagactt attccttact ttgaaaggga
   16351  agcatcctaa cttacctgat aaagataagg actttcacat agctatgatg
   16401  ttgtatcgtt tagcagttaa gagttcatca ttacaaagcg atgacgacgc
   16451  cacgggtata acgtacactc gggagggtgt tgaagtggat ttgtctgaca
   16501  aactttggac tgacgtcgtg tttaactcta agggtattgg taaccgtact
   16551  aacgcccttc gagtttgggg tagaaccaac gatgcccttt acttagcttt
   16601  ttgcagacag aatcgcaatt tgagttatgg cggacgtccg ctagacgcag
   16651  ggattccggc cgggtatcat tacttgtgtg cggatttctt gactggagct
   16701  ggtttgactg atttagaatg tgctgtgtac atacaagcta aagaacaatt
   16751  attgaagaag cgaggggctg atgatgtcgt agttactaat gtcaggcagc
   16801  ttgggaaatt caacacacgt tgatctgttg cgttccgatt cccggtttct
   16851  atcgggatgg tggagtttca tcgtgaacgt gggtgatata atcgtccggt
   16901  tcgcgttaca cgttcctaat gaagatatgc tgaatagttt ttcagctata
   16951  tcgaattgta cgattatagc ggacggtagt gctttactaa aagataatac
   17001  tgtggtcgat cgtttagaag gcatgaatcc tttggcttat ttattaaaat
   17051  tagcgaaaac gactactact atttgtttta ctatgtctaa taaggttctt
   17101  tttggtacta ctaaatccga accacttagt tgtttagcta tcacgtcgga
   17151  tcgagtttta ttcaaagttg ttatgggtac taacgttgac gattctcgat
   17201  gcggctgcag tatttggttt tacaacaacg gtacgtttca aaatggattg
   17251  atccgttgta ataatctcgt cactttgttt agcgtgactt agacacgaag
   17301  tgactgttcg gattcaattg ctgcaatgag ctttcggcgt ttgtggttaa
   17351  aggttatggc tgtagttacg gtattatggt acggtaaaga gccttccatt
   17401  agtgaaggtt acaatgctct catgaatgat gactttaagt ttatcgatac
   17451  gcattttaca aacgtttctt atgctaagaa atgttacgat ttggctaatt
   17501  tcgatttaga ctttctacgc atcgttatca ttcctttgag tggtggtacg
   17551  gtgaatgaat cgcgtgctga tcgcactaac gtttcagaaa ttgtcgaatc
   17601  gcatgtgagc gaccgagaca ggatgagcat cttgttgcgt aataagcgga
   17651  tccaaattcc ttcgctctta ccttgcgata actagagtct actcagtagt
   17701  acgtctatta gtataacgta ttaagcactt tagtaaaggg ttttgtttaa
   17751  atcaaacaat atgcgagctt actttagtgt taatgattac ataagccttt
   17801  tggctaaggt cagcgctgtt gtggaacgtt tatgcgatcc cagcgtacct
   17851  cttgcggaag tgatggacga aattaatgac tttaactcgt ttctcgcttt
   17901  agtgcactct atgaagtcag acatgaacgg agaccatcag gatggccacc
   17951  acgagatggg tgaacacaag tctcggttgt tatgcaacat agaggcgaaa
   18001  ttgcgagtac ttctcgacat cataagacgt cggttcactc gcgacaagct
   18051  gctctgtact agcgcgacag atgtcatggg cttctttgta atgaggtaca
   18101  tgagttctag ccacaccagc ttcgaatccg taatgaggac ggagttgagg
   18151  ttggtggtta aggcggtact gtcggattta tcccgcgcgc ataaactgga
   18201  ttttagcgag cgagcttttg cggcttatgg tatccttttg caaaagggta
   18251  ctgtgtcgac cgtttgcggt cagtttgaca ttaatttagt ctctccatct
   18301  tgcgtgtagg ttaatacgct tctcagaacg tgtggttgta ttaactaact
   18351  ttaattcgaa cgaatatatt gtgaaagtct gcgagttacg atggataata
   18401  ctagcggaca aactttcgtt tctgtgaacc tttctgacga aagcaacaca
   18451  gcgaccactg acgtcaaacc cgtgagttcg gaagcggatc gcttggattt
   18501  tttacaaaaa atgaatccca ttattatcga tgctttgata cggaagaata
   18551  gttatcaggg cgctcgcttt cgcgcgagaa taataggagt gtgcgtggat
   18601  tgcggtagaa aacacgataa ggggttgaag actgaacgta agtgtaaggt
   18651  caacaatacg cagtctcaga acgaggtggc gcatatgtta atgcacgacc
   18701  ccgttaagta tttaaacaaa agaaaagcta gagccttttc taatgcggag
   18751  atatttgcga ttgatttggt tatgtacacc aaggaaaggc aattggctat
   18801  tgatttggcc gctgaaaggg agaaaacgag actggctcgt agacacccga
   18851  tgcgttctcc ggaagaaact ccggaatatt ataaattcgg taggactgct
   18901  aaagcaatgt taccggacat caacgccgta gacgttggtg ataacgagga
   18951  aacttcgtcg gagtatccag tgagtctgag tgtttctggc ggagttctcc
   19001  gtgaacacca cttcatctga ttgaagtgga cggaataagt tcctcgcgga
   19051  actttgtgtt gggttggtaa agacccttat gatggtgata tatcactaga
   19101  caataaccgg atgggtaaag tctttaaaat gatcgagggg aaaattaacc
   19151  gtatcctctc gttggtctaa gctcccacag agtggtagtg gtctcaagtg
   19201  aggcttaacg tatgcgtgaa ccaaagaagt tctccttaga gtgtgtgttg
   19251  tttaccaaca cactgtccct atggggggcc aacataggtc ca