Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS701-T36, complete genome.

ACC No: KC517486

Dated: 2013-04-30 | Length: 19283 | CRC: 1801496053

                
ID   KC517486; SV 1; linear; genomic RNA; STD; VRL; 19283 BP.
XX
AC   KC517486;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FS701-T36, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19283
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19283
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19283
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="FS701-T36"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: T36"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9467
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30071.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIVVLHYFGSVRITKV
FT                   IRDKSADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGLPVINASGVVRPR
FT                   SVAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPRGTRSRLHRRVVR
FT                   RADTAPVESPQDKPTRRNSRLGKTSHLPYMGEAALDDILRWIEEVNPHPSMVAIPVPIT
FT                   FGTMPATAWCSRSEAAVLRCRLDYHAAETDFSTQEKHVRYVYNDVSSATNRPRTVSPRK
FT                   CGSIFPSKSKLGVEVPSGRDFHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVLMSDGVNTARLDVVAPAYYAYAKSLGARVRFLWESSDLDDAKV
FT                   RDGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGTSAHVLIGQVQVSIPGSIVKPSRSAVRRRNR
FT                   RMRRDGFLGSSGSSSSAGESTHCSDCSSPRSPSVLKPSLGRIPSIDRRFRFPAGTQLRV
FT                   SVPRRVDDHVYVSTGSNFDELCHAVCTYVKRYNSRKSFYTRFESGRDYLVLRRASVGGL
FT                   HVFVKRGNFTARFPISAVRYENQYAAVMMDVGTSWVPKGYVPDVDVVKRRRSRNRRFSL
FT                   SHRAVDQSVPALQSSPVEVASVSSDKPSSSQKASSPSTSSSSSFNSTRSSDWVNVGLSH
FT                   RTTNKVREPRSAGHRRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSFLRILLARL
FT                   SGYRPLSDEFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIG
FT                   SGGLLGLDSYGFSESLKDGYCYIRHFAEVSLSMGRIFFRRDVNLGPFPYVFEVQHRLER
FT                   LYGKAALRYGVRGQYSAPRCFHCCYNDSPRPMASFNGYHKMGGEDNSLIITDTDRLRAV
FT                   GSAYEKVKRNIPDSLLVRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTRAY
FT                   PEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCR
FT                   PVYDVKDAHRRVVRHHQLSKVSLDQSDGVKQVGAVNTNSVCGNILGECYHASEAMVMVQ
FT                   VYDVPLRELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPIADRVVYC
FT                   FNNSAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISETKR
FT                   LRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFE
FT                   WTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAF
FT                   SGETSIFELVRFAISEKCRDLFLGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISEYS
FT                   ELDVPIDLPGFGGIVDGNETRLMEDGVKSALLRKAVQAEAQLSLKRGNTSEIVPCDDDD
FT                   DSNGDDSRVSHDSDGGSSSGGSSGGLRAGAAPSLFRCLLRKLGGGLCLAKKVLELLVKR
FT                   VVESFSRLKRKTARLTSFANLLLARLSCGFFDDTVFSAVWEIAINLTRIVDGVVKTKLG
FT                   CFRNLFRLIPKLYAGCKDVVKDVSNAYRSVVLFSAEVLGKSYSKLCQFCLEIFDIGLIE
FT                   VSARNLGLETCVSIALAIFDVLITFPLGSVSFPVVCARVFGALAMEVGSNFLFKKVFGK
FT                   PETLGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEDDAWVG
FT                   YSKHEVSSLPIVTFCVKRLSYSLERCKEACVAFIVDSAKKILKSLTSEFNESIQNSDLT
FT                   SGAKSLYGHVSSILSTSSGVINKAGSAVATVKAVGSDISGRVKRMRPRFSLSRHFDEQT
FT                   SEYYSASDCSELDESLFSETPGLRGNGRCRDLFRIVSRRAVACCEYVTILLKRLASRAG
FT                   EYSYSYVMDTLVKLYVATDDVVRRCRSFTFDCTDKASNFVTGFLSWRSLRSGAYSATPG
FT                   LGGGSRGLTSFSHTGGFTRVIGALGNTLSVVFDEEFFRTLLHRLRTDVVVLLVEFLKNL
FT                   PVCLFSIYTFFECRGRIFPLREFLWGFCRFVWDVIEGLSINAYQYLSAVAEKVYRGAFN
FT                   RRFNEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEVSSSRSSDSPSFPPTYGEI
FT                   EELNDDSSDSALVIGVDNGTGRTIVDGETDSASGSDSDVSIPLDRDFEQIGGLGGNGNV
FT                   DVVRLGLKFVLKLLRNLFGARSFKVLYGLLLQTLFYGGSVNKFVSRLVFSLGTCLPFEL
FT                   LRFACSARRLLKSLASFVYQTNLFSEVMVEHLFSVSRLLYDSRYFATVFSELERLNFYL
FT                   DYFLSLPKRYLFPNSRARSCARVPVPVIRTEGVAPVCERSLNDILDTLDSLKVSDLKGK
FT                   STFVDDGESDSGSEHSGSSISFGSVNEEVLNAVNGDGVCEKAPLMKHVTALSRLEPDPS
FT                   GRKDIPVSRKTFVRGESSGVKSKVSMCDYLVTLNSSFGTVPDMYPVARDITYKKLTNAM
FT                   REFYYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGS
FT                   HPFRNTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNE
FT                   EHSLIVYEAPPGGGKTHSLVNCYADYCVKVSCLVVTANKNSQTEISQRISNELMGRKLA
FT                   AKYVTGAASRVFTVDSYLMNHLRLTTQLLFIDECFMVHAGAIGAVVEFTSCKAVVFFGD
FT                   SKQIHYIHRNDLGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICEWLSEFYPRHVATANV
FT                   GSIGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRNKVVPIVNTV
FT                   HEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNID
FT                   RAKEIFDKFRSSNHSYGSSSLEWYLEKYPTEYKGSKASSAPISCINEFLNEVVVGSSVV
FT                   QLGDVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVTARKP
FT                   SVVRKS"
FT   CDS             <9340. .10842
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30072.1"
FT                   /translation="ETPPLLTRVTYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPSEFGRAMAAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIK
FT                   AVQAELKLPFSVEEQISNFKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTEMTNAGLAEIIRRIIGDDDNLFVGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFDLLLVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQNKLTDVELFELFTSFKDMTQDFGDQVVLEKLK
FT                   LLVEAKYGFTSGTTMPALCAIHCVRSNFLSFERLFPFIRGWYVVDALKLRQLRKLTNLI
FT                   CERVVYDNRVSYFSYFDNPFTKPDANDDNVDDLGQAGELATG"
FT   CDS             10891. .11802
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30073.1"
FT                   /translation="MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDR
FT                   DPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKT
FT                   FDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFFFRAVSETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLG
FT                   DSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYVAEYNENARSRVSLIRRVCC
FT                   YAVCVLVVSVLIMSGLLAIIFI"
FT   CDS             11876. .12031
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30074.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRSASPY
FT                   GTHATV"
FT   CDS             12037. .13821
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30075.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATPSELVILKQSNSSYIPTCLFLHAEPN
FT                   SVSYGYDAEYLAASGESGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVIVKEFGTKSVP
FT                   VPYLSPLNNDLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLNSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFVPQKELNVSSLKEALSLQTDPVKYTVNHYG
FT                   MSETVSIDQTVLREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDA
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWS
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSRYDYAGMPHPTRKLVRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13745. .15352
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30076.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLMSRGEDFADVAAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSSVSGVTTKLEIYLSYCMSLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDLRLAADNPD
FT                   LRVGLRWAGMFVYYGVYRCAVDRAVERPTLFRLPQKLLSQDEGESCSLHMSSVEALFNL
FT                   VQKVNKDINVRRQFMGRHSEVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRIPDG
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYSTS"
FT   CDS             15327. .16049
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30077.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLYTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKFACTFEELHL
FT                   CMARLRPDLYENKRTTRAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16143. .16814
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30078.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDIVVTNVRQLGKFNT
FT                   R"
FT   CDS             16780. .17283
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30079.1"
FT                   /translation="MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNLVAL
FT                   FSVT"
FT   CDS             17317. .17676
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30080.1"
FT                   /translation="MSFRRLWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFT
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17752. .18300
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30081.1"
FT                   /translation="MRAYFSVNDYISLLAKVSAVVERLCDPSVPLAEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELRLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             18382. .19011
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30082.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTATTDVKPVSSEADRLDFLQKMNPII
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19012. .19283
XX
SQ   Sequence 19283 BP; 4692 A; 3844 C; 4869 G; 5878 T; 0 other;

kc517486 Length: 19283  30-APR-2013  Type: N  Check: 9845  ..

       1  aatttctcaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gccatcgctg
     151  ttaacagcga ttacacgata tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttctgttaga atcaccaagg tgattcgtga
     251  caaatcggct gatatgccga tagtcccttt acggaaatct gtatttccgt
     301  tttctgttcg cgcggctgtc cgcgcaattc gtgctgctgg gcgtcctctt
     351  gacgctccgc attcagggtg cctctgtggc cttcccgtta tcaacgcatc
     401  tggcgttgtt cgtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc gctcacctct gccgctaaga ggtccctccg ccaggcaaag
     501  cgggaatctg tttccctttc tagccgggcc tcttctcgct tctctaggga
     551  agtccctcgc ggcacacgtt caagacttca tagacgtgtg gtgagacgag
     601  ctgacactgc cccagttgag agtccccaag acaagcctac ccgacgaaac
     651  agccgacttg gtaagacttc tcacctccct tacatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga ttgaagaggt taatcctcat ccctcgatgg
     751  tcgctattcc agtgcccatc acttttggaa ccatgcctgc aacggcttgg
     801  tgttcccgtt ctgaagccgc agttttgcgg tgccgccttg actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acacgtacgg tacgtctata
     901  atgacgtatc ttctgccact aaccgtcccc gtacggtttc tccccgcaag
     951  tgcgggtcca tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac tttcacactg cgttcgtgag atcttctcac gcgagcgctt
    1051  tcttctctga cgcggttcgc cgcgttcgtt tgttccgtcc agcgcggaac
    1101  aattttttca cttccgtcgt cagcggacga cgtgtttgct attacagacc
    1151  cggtccgtgt ggtacggtgt ctgttttaat gtcggacggt gttaacacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taaatctttg
    1251  ggcgccagag tgcgcttttt gtgggagtcg tccgacttgg acgacgctaa
    1301  agttcgtgac ggtcaatgtt atgtccgtca tgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ctttccgtgc gtagagcact gggtatgtac
    1401  cccacagtgg gtgcactaaa ggcttatctt gttcgcgaat acggtcgcga
    1451  ctctcttaag gttcctatgc gtgggaccta cacttttggc agtgtgtttc
    1501  actgcttgtc gactaaatct tcagtcgacc tgcgatctat tcctaaccat
    1551  catttagttg gtgggacgtc tgcccacgtc ttaattgggc aggttcaagt
    1601  cagtattcct ggctcgattg ttaaaccttc acgttcggcc gttcgtaggc
    1651  gtaatagacg catgcgacgt gatggttttc tcggtagttc cggttcttct
    1701  tcttctgcgg gggagtcgac tcactgttcg gactgctctt ctcctcgctc
    1751  tccttccgtt ttaaaacctt ccctaggtcg gatcccgagt atagatcggc
    1801  ggttccggtt tcctgcgggt acgcagttgc gcgtctccgt acctaggcgg
    1851  gtcgatgacc atgtttacgt gtcgactggt agcaacttcg atgagttgtg
    1901  ccatgcagtt tgcacgtatg tcaaaaggta caactctagg aaatcctttt
    1951  acactcgatt cgagagcgga agggactact tggttttgcg gcgtgcttcc
    2001  gttgggggtc ttcacgtgtt tgtaaagcgt ggcaacttta ctgcccgatt
    2051  tcctatttcg gcggtcaggt atgagaatca gtatgccgcg gttatgatgg
    2101  atgtggggac tagttgggtt ccgaagggct acgttcccga tgttgatgtt
    2151  gtgaaacgtc ggagaagtcg taatcgtcgt ttttctcttt cccatcgcgc
    2201  ggtggatcag tcggtccccg cgttacagtc gagtcctgtc gaggttgctt
    2251  cggtttcgag tgataagcct tcatcgtcgc agaaggcttc ttcaccttct
    2301  acttcttctt cttcttcttt taactcgaca aggagttcag actgggtgaa
    2351  tgtcggtttg tctcatcgaa ctactaataa ggttcgtgaa ccgcgttctg
    2401  ctggtcatcg taggatcgga aattttactt tcccgagggg cacagtgtac
    2451  aacacgcctg tcgatgagcg cgcctataaa cgtgttctta gattgcgaga
    2501  taccacagcc tgttcctttc tccgtatact gctagctcgt ttgtcgggtt
    2551  acagaccttt aagtgacgag ttctttaaca agtgtgtcac ttcccggttt
    2601  gtcgcgtgca ttgaacctgt ggaatcaggt ctcgttaagg tgcattttcg
    2651  ttctgatgtt ttccgtgcct ctttcccgtt tggggtcaac ctatacaccc
    2701  gccacgcgtt tgacattgga agtggtggtc tcttgggatt ggatagttac
    2751  ggcttttcag aatccttgaa ggatggatat tgctacattc gccatttcgc
    2801  cgaagttagt ttgagcatgg ggcgaatttt cttcaggagg gacgtcaact
    2851  tgggaccttt cccatacgtt ttcgaagtgc aacaccgtct tgaaaggttg
    2901  tacgggaaag ctgcgttaag atacggtgtt aggggtcaat attcagcccc
    2951  gcgctgtttt cactgttgct acaacgattc accgagaccg atggcgtcct
    3001  ttaatgggta ccataagatg ggtggtgaag ataactccct gataatcaca
    3051  gacaccgaca ggttgcgtgc tgtggggagt gcctatgaaa aagtgaagag
    3101  aaacatacca gattcgttat tggttcggtc tgtagaaaag gaccttatag
    3151  agtttaatca gactctagtc gacatgcatc gatccagacc gggcgttgtc
    3201  gtacctttcc aaatgagtga gaatcagcaa gtgatgctta ctagggcgta
    3251  cccggaattt aatattaatt ttattcattc cgtacattcc gatcatccgg
    3301  tggccgcagg ttctagggcg ttggagaatc atctcgttcg taaacacgct
    3351  ggtaccgatt attcggatgt ggggggttgt ccgctgtttc atttacgtgc
    3401  gggtcactcc ggcgttcacg tttgtagacc ggtgtacgat gttaaagacg
    3451  ctcatcgtag agtagtccgt catcaccaac ttagtaaggt ttcgctagat
    3501  cagagtgacg gtgttaaaca agttggtgct gtaaacacga attctgtatg
    3551  cggtaacatt ttgggagagt gttatcatgc atcggaggcg atggttatgg
    3601  ttcaagttta tgacgtaccg ctacgtgagt tgtgtagggc tatgataaac
    3651  aagaaaactt ccgtgtgtta tatgaccatg gttacacctg gtgagttgtt
    3701  ggacgcccgc gagtcctttt ttattaagga cttggattgt tcggttgagt
    3751  tagatcccat tgcagacagg gttgtttact gtttcaacaa ttctgcgtat
    3801  acacacacgt actcaactat atgtgagtat atgcgaactc cttgcttggt
    3851  agtggacggg tttttgttta ctatcgaaat ggtatcgctc aggtgtagcg
    3901  ttaattacta ttgtatcacc aagtcgtcgg tctgtccgag aattagtgag
    3951  actaagcggt tgcgctaccg tcggtgtgat agcgacttga ttagaatcaa
    4001  aattccccgg tactccagta agactcgtag ttgtttacct gggtgttact
    4051  atttgtactt ggacgccaag tttgtaagtc gcgtgtacga gtacgtggtc
    4101  aataactgcg ttgtggtgaa cgcgaaaact tttgagtgga cctggaatta
    4151  catcaaatct tgcaagtcga gagtggtgat cagcgggaag attatacacc
    4201  gagacgttcc aatcgcttta gagtacttag atgggttttc tgcggttatg
    4251  ctgtccgctg gtgtgaaggg taggcaaaac gcggaagcgt tttctagacg
    4301  cttagccgct ttttcgggtg aaacttcgat tttcgagtta gtgaggtttg
    4351  ctatatccga gaagtgccgc gacttgttct tgggtattca ggatgctgtg
    4401  gaaagatgcg tgaagtcgta cctcaggaat tcgtttaata tgagtttcgt
    4451  ggacttgtcc gaccccttac ttacgattag cgaatattca gaattggacg
    4501  ttcctatcga cttaccgggt tttggtggaa tagtggacgg taacgaaact
    4551  agacttatgg aagacggtgt taaatcggct ttattgcgta aagcggttca
    4601  agccgaggct cagttgagtc ttaagagagg caatacttcc gaaatcgttc
    4651  cgtgtgatga cgatgacgac tcaaacggtg atgattcgcg tgtttcgcac
    4701  gattcggatg gtggttcgtc ttcgggcggt agttctggcg ggttgcgagc
    4751  tggagccgcc ccttctttgt ttaggtgttt actcaggaaa ttgggtgggg
    4801  gtttatgttt ggcaaagaaa gtgttggaac tgttagtcaa gcgggtggtt
    4851  gaatcgtttt ctcgtttgaa gcggaaaacc gctcgtttaa cgtccttcgc
    4901  taatttgttg cttgcgaggc tctcttgcgg gtttttcgat gacactgttt
    4951  tttctgcggt ctgggaaata gcgatcaacc tgaccaggat cgtcgatgga
    5001  gtagtcaaga caaaactggg gtgctttcgt aatttatttc gattgattcc
    5051  caagttatac gctggttgta aggacgttgt gaaggacgtt agtaacgctt
    5101  acaggtcggt tgtcttgttt tccgctgagg ttttgggtaa gagttactct
    5151  aaactttgtc agttttgctt ggaaatattt gacatcgggc ttattgaggt
    5201  ttctgctcgt aatttgggac tggaaacatg cgtttcaata gcactggcta
    5251  tttttgatgt gttgattact tttcctttgg ggagcgttag ttttcccgtc
    5301  gtttgcgcta gggttttcgg tgctctcgct atggaagtgg gatcgaactt
    5351  tttgtttaag aaagttttcg gtaaacccga aactcttggt gaagatgctt
    5401  tccgtaggac tgtgagtatg gttttgagcg ccaaagcgtt tgacaagctt
    5451  tccgtggatg cgaaaggttt agttaggtgc tctggtgtta ttcctggagt
    5501  gttaaggata atactatctt ccttgttttc cgaagatgac gcttgggtgg
    5551  gttatagtaa acatgaagtt tcttcccttc ctattgttac cttttgtgtg
    5601  aagagattgt cttattctct ggagcggtgt aaggaagcgt gtgtcgcatt
    5651  tattgttgac tctgctaaga agattttgaa atctttaact tcagagttca
    5701  acgaatccat tcaaaactcc gacttgacta gtggtgctaa gtccttgtac
    5751  gggcacgtga gctcgatact ttccacctct agtggtgtga ttaataaagc
    5801  aggaagcgcc gtcgctactg ttaaagcggt cgggagtgat atcagtggtc
    5851  gtgtgaaacg tatgcgaccc cgattttctc tgtcccgtca ctttgacgag
    5901  cagactagtg agtactactc tgctagcgat tgttccgaac tagatgagtc
    5951  gttgtttagt gaaacgcctg gtcttcgtgg aaacgggagg tgtagagatt
    6001  tgtttcgtat cgtgtctaga cgcgcggtag cgtgttgtga gtacgtgaca
    6051  attcttttga aacggctagc gtcgcgtgcc ggtgaatact cctactcgta
    6101  tgtgatggat acgctcgtga aattgtacgt ggcgaccgat gatgttgtta
    6151  gacggtgcag gtcctttacg ttcgactgta ctgataaagc atctaatttc
    6201  gtcaccgggt ttctcagttg gcgcagctta cgttctggtg cgtattctgc
    6251  aactccaggg ttgggtggtg gtagtagagg tttaacgtcg ttttctcaca
    6301  ccggtggatt cacgcgcgtt atcggcgctc ttgggaacac cttatcagtg
    6351  gtgtttgatg aggaattctt cagaactttg ctgcatcggt tgaggacaga
    6401  tgttgtggtt ttactggtgg agttcttgaa aaaccttccc gtttgtttgt
    6451  tttcaatata cacttttttt gaatgtcggg gtaggatctt tcctttaaga
    6501  gagttcctat ggggtttttg tcgtttcgtt tgggacgtta tcgaggggtt
    6551  gtccatcaat gcttatcaat acctctctgc tgtcgctgag aaagtgtatc
    6601  gaggtgcctt taatcgtcga tttaacgaag aggatgagag gacgcttcga
    6651  gtgatcacgg aagcagaggg aagaatcgaa tttttgcgag ttgttctcgc
    6701  ggaaatggaa aggttccgtg ctgcgtcgaa cgaggtttct tcgtcgaggt
    6751  cgtctgatag tccttcattc ccacctactt acggtgaaat tgaggagtta
    6801  aatgatgatt cctccgatag tgcgctagtg ataggcgtcg acaacggtac
    6851  cggccgcact atcgttgacg gtgagaccga ttctgcgtcc ggtagcgata
    6901  gtgacgtttc tatcccgttg gatcgcgatt ttgaacaaat cgggggtctt
    6951  ggcggaaatg gtaacgtcga tgtcgttcgg ctgggtttga aattcgttct
    7001  gaagttgtta cgcaacctat tcggtgctag aagttttaaa gtgttgtatg
    7051  ggttgttact tcaaaccctt ttttatggtg gttcggtaaa taaatttgtg
    7101  tctcgtctgg tctttagtct tgggacttgc ttacctttcg agttactccg
    7151  atttgcgtgt tcagcgaggc ggttgttgaa gagtttggca tcatttgttt
    7201  accagactaa ccttttcagc gaagttatgg tggagcattt gtttagcgtt
    7251  tcccgactgc tttatgattc ccggtacttc gcgactgtgt tttcggaatt
    7301  ggagagactt aacttctatt tagactattt cctttcgctc ccgaagagat
    7351  atctattccc taattctagg gctcgtagtt gtgctagggt tccggttccc
    7401  gtgattagga ccgaaggagt ggcaccagtc tgtgagagat cactaaatga
    7451  catattggac actttagact ctttaaaggt gtcggacctc aaagggaagt
    7501  cgacgttcgt tgatgatggg gagtcggatt ccggtagtga acattcgggt
    7551  agttcgattt cgttcggttc cgtcaacgaa gaagttttaa atgcggtaaa
    7601  tggtgacggc gtttgcgaaa aagccccgtt gatgaagcat gttaccgcac
    7651  ttagcaggtt ggaacccgac cctagtggtc gtaaagacat tcctgtttct
    7701  aggaaaactt ttgtgcgtgg tgaatcttcg ggtgtgaaat cgaaggtgag
    7751  tatgtgcgat tacttggtga ccttgaattc ttcgtttggc acagtgcctg
    7801  acatgtaccc tgttgcgcgt gacataacgt ataagaaact gactaacgcc
    7851  atgcgcgaat tctattactc gcaaaaaata accttgtacg aacttcacgg
    7901  gaagttgagt tcctattggg acgagttgaa ggtcgcaggt ttcgatagaa
    7951  agttaacgag aatggatttg gacgatgatg tctatgttgt tgactttaat
    8001  cggaaattgt tggtggggag aaacggatct catccgtttc gtaatacgtt
    8051  aaagtcctat tgttttatgt tttgtaacga tgggttggtt ccttgcccgg
    8101  gttctcagaa atatgattat gctttgattt ctaatcaaac gtcttttgtt
    8151  gccgcgaatt cgttcttacg tgccgtggat ggtaaggatt tgacttttac
    8201  caatgaggaa catagcctta tcgtttatga agctcctccc ggtggtggta
    8251  agactcattc tttggtgaat tgctacgcgg attattgcgt taaagtatct
    8301  tgtttagtag tgaccgctaa caagaattct caaaccgaga tatctcagcg
    8351  tatatctaat gaattgatgg gcaggaagct agctgctaag tatgttaccg
    8401  gtgcagcttc cagagtgttc actgtggatt cttacttaat gaatcacttg
    8451  cgacttacga ctcaactgct gtttatcgac gagtgcttta tggttcatgc
    8501  tggggcaatt ggagccgtgg ttgagttcac gtcttgtaaa gcggtggttt
    8551  tctttggtga tagtaagcaa atccattaca ttcaccgaaa cgatctcggg
    8601  gtttctttgt tgcatgatat tgatgcgttt attcaaccgg aacatcgtat
    8651  ttacggcgaa gtgtcctata gatgtccttg ggacatttgc gagtggcttt
    8701  ctgagtttta cccgcgacac gtagctactg ctaatgtagg gagtattggg
    8751  aagtcgagtg tgtcaataga ggaaatcaat gggtgcgatg acgtacctta
    8801  cgacaaggcg gcgaagtaca ttgtgtacac tcaggctgaa aagaacgatt
    8851  tgcaaaaaca cctcggtcgc ttaaccgtgg gtcggaacaa ggtagtacca
    8901  attgtaaata ccgttcatga ggtacaagga gagacctata aaagggtacg
    8951  tctggtgagg tttaagtatc aggaggatac cccgttctct tcaaagaatc
    9001  atattgtggt tgctttgact agacatgttg attctttggt ttattccgta
    9051  cttactagta ggaggtacga cgatactgcg actaacatag atagggcgaa
    9101  ggaaattttt gacaaatttc gttcgtcgaa tcactcgtac ggttcgtcat
    9151  cgttagagtg gtaccttgaa aaatatccta ccgaatataa gggtagtaaa
    9201  gcatcctctg ctccgataag ttgcattaac gaattcctta atgaggtcgt
    9251  cgttggttct tctgtcgtgc agttgggtga tgtgtctgaa gaactaagtt
    9301  cacgtccctt tgaatcgggt tgtgataatg ttactgtaag agacaccgcc
    9351  cctcctgact cgggtaactt acacgaaccg gctcgcgttc ggcgtagtaa
    9401  ggtcacaagc aattcctcca agaaaagcgt cactgcaaga aaaccttctg
    9451  tcgtacgaaa gtcgtaatta taactttatc aagacggaac ggtttgttgg
    9501  accaagcgaa tttggtaggg cgatggctgc tgctgttatc gaacgttgtt
    9551  tcaaaatgga agagatggct aagataaggt gtgatattat atcccttact
    9601  gaagctaaca ttttaaaatg gctcgataag cgaactccct gtcaaataaa
    9651  ggccgtacag gcggagttga aacttccctt ttcggtggag gagcaaattt
    9701  ccaacttcaa actgatggtt aaacgtgatg ctaaggtaaa acttgacgat
    9751  tcaagtctat ctaaacatcc cgctgctcag aacatcatgt ttcataagaa
    9801  gtttatcaat gccatatttt ccccgtgttt cgacgagttc aaaaatagag
    9851  tgttgtcctc gcttaatgac aatatcgtgt tctttactga gatgacgaac
    9901  gctgggttag cggaaattat cagaagaatc attggtgacg acgacaactt
    9951  atttgttggg gaagtggatt tcagtaagtt cgataagtct caggatttgt
   10001  tcattaaaga gtacgaacgt acgttgtatt ccgagtttgg gttcgatacc
   10051  gaacttctcg atgtgtggat ggaaggtgag tatcgcgcta gagccaccac
   10101  gctggatggt cagctgagtt tttcagttga tggtcagcgt cgttctggag
   10151  gttcaaacac ttggattggg aattccttgg ttactctagg tatcctttcg
   10201  ttatattacg acgtttcgaa gtttgactta ctcctcgttt ctggagacga
   10251  ttctttaatt tattcgagtg aaaagataag caacttttct tccgaaattt
   10301  gcttagaaac aggttttgag actaagttta tgtctccgag cgtgccatat
   10351  ttttgctcaa agtttgtggt tcagaccggt aacaaaacgt gttttgtgcc
   10401  tgacccttat aaattattag taaagttggg ggctccacaa aataagttaa
   10451  ccgatgtcga gttatttgag ttgttcactt cttttaagga catgacgcag
   10501  gactttggtg atcaagtggt tttggagaag ctgaagttgc tagtcgaagc
   10551  taagtacggt ttcactagtg ggaccactat gccagcattg tgcgctattc
   10601  attgtgtgcg atcgaacttt ctgtcctttg agaggttatt tcctttcatt
   10651  aggggttggt atgttgttga cgctctaaaa ctcagacagc ttaggaaact
   10701  cactaatttg atctgtgaac gtgtagttta cgacaatcgg gtgagttatt
   10751  tttcgtactt cgataacccg ttcactaaac ctgacgctaa cgacgataac
   10801  gtggacgacc tcggacaagc gggtgaatta gcaaccggct gatcgattga
   10851  ttagttctcg ctgagagcta atgtgggtag ttgagtcggg atgtttgcct
   10901  tcgcgagcga aagccaagac ttgttagaag aaaaagtttt tcgtcgtaga
   10951  acttaccatc gtaaatattt cggtgacgtg gttaaggact tcactatcga
   11001  tattggttat gatactaccg atcgcgatcc tactgtattg gccgattatt
   11051  tctcattgta tttcttttta cttaacaacg atagtgttgg gcctatagca
   11101  gcttcaattg tggtaagccc accggttagc gggactcata aaattcgagc
   11151  gcatatcgat aatcaaccga actgtgaagg taacgtgact tacgttaaaa
   11201  ccttcgacaa aagtcgcttt gtgattcgcg taaaagcggt ccccgcttct
   11251  atgagaggtt actactcttt tcgggtgttt cttagtagcg atgttgctag
   11301  cgaacgcagc gagttcgtgt gcagttttgt tggtagcagg tttctttgct
   11351  gttgtacaca aacgatatct gaaaatttga gtaaagtttg ttcatcttcc
   11401  ttcttcttca gagcagtttc agaaaccgcg accaacgaat tttctgttgc
   11451  gactgatgat gtggaagacg ttaagtacat aagaaaacaa gccgagggtt
   11501  tttcacgttg cgctgaccca taccctccta ggtgttatcg tagcactaat
   11551  ttgggcgatt cttcaggggt tcagagtcgt acgattgaag aggaaggtta
   11601  tatgacgggc actgcaggta acgtcgcagt caccgtcccg aatactccac
   11651  tagttagtgc tgtctctccg tatgtcgcag agtacaacga gaatgcacgc
   11701  tcgcgcgtct cattaatacg ccgggtctgt tgttacgccg tttgtgtttt
   11751  agtggtgtcc gttcttataa tgagcggttt attagccatt atatttatat
   11801  gatttggtgt agtaactcat aaggtacaat cacttactta agactcgccg
   11851  tttgactctg tttaaacggg gtttaatgga ctgcgtaatt caagggtttt
   11901  taactttcct agttggtata gctgtgtttt ctgcatttgc cggactgatt
   11951  atcattgtta taacaattta tcggtgcacg actaagcccg tcagaagtgc
   12001  ttccccttac ggcactcacg cgactgtcta agcggtatgg tgcttttggg
   12051  tttagacttc ggtaccacgt tttcaacggt ggctatggct acaccttcag
   12101  agttagttat actcaaacaa tccaattcat cgtacatacc tacgtgttta
   12151  ttcctgcatg cggaacctaa cagcgtatct tatggttacg atgcggaata
   12201  tttagcggct tctggggagt ctggttcgtt ttacaaagat ttgaagcggt
   12251  gggttggttg cactgcgaag aactaccaaa cctacttaca caaactatca
   12301  ccttcctata aggtgatagt gaaagagttt ggaactaaga gcgtgccggt
   12351  gccatatttg tcacctctga ataacgattt aggactcagc gtcgctttac
   12401  cttcactgat cgcttcgtat gccaaatcca ttctgtcgga tgcggaacga
   12451  gtgttcaatg taagctgcac tggagttata tgttcggtac ctgctggtta
   12501  taacacgtta caacgagctt ttacacagca gagcatatcg atgtcgggtt
   12551  actcttgtgt gtacattatt aacgaacctt cagcagccgc gtactccact
   12601  ttacctaagt tgaattcggc agataagtat ttagccgttt acgacttcgg
   12651  cggtgggact tttgatgtct ctatagttag cgttagatta cccactttcg
   12701  ccgttagaag ttcgggcggt gacatgaatt taggcggtag agatatcgac
   12751  aaaaagttat ccgataaaat atacgaaatg gctgattttg tgccgcaaaa
   12801  agaattgaac gtttctagtt taaaggaagc tttatctctt caaaccgatc
   12851  cggtcaaata tactgtgaat cattacggaa tgagtgagac cgtatcaatt
   12901  gatcaaacgg tgttgaggga gatagcctcg gtgttcataa atcgaacgat
   12951  agatatactt acgcaagtta aggttaagtc tagtatgccc gaatcgcaaa
   13001  gtttgaagtt agtggtagtc ggtggaagct cgtacctacc agggttgttg
   13051  gacgctttgg caaccgtgcc ttttgtgtct gggatagtgc cggtggaaga
   13101  cgcaagaacc gctgtcgcca gagggtgcgc tttgtatagc gagtgcttag
   13151  atggtaggtc taaggcccta ctaatagatt gtattacgca tcatttgtcg
   13201  gtcacgacgt ttagcgcgga ttcggtcgtt gttgcagcgg ccggtagtcc
   13251  aattcctttt gaaggtgaac gaaaactcac gttacgcaaa tgcgttagta
   13301  cgtctaacta tcaagcaaga atgttcgaag gggattacga aaaagttttc
   13351  cgaaatgaac gtatatacgc agcttcggta tcattgttta cattaggagt
   13401  taattggagt gtgcctaacg acgttgagat gactctcgtg accaaagtgg
   13451  actcgatggg taaagtggaa ttttacctta aaggtccatc tggtgaactg
   13501  gttaacgtgc aaggtacttc gcgttacgat tatgctggta tgcctcaccc
   13551  cactagaaag ctggtgaggc ttagcgatta caatgtaaac tccgccgctt
   13601  tagttttagc tttgacatta actcgcgaaa aacgagaaaa gttccttttg
   13651  cgaacattat ttgacacttt actagcggat ttacgaaaga cagcaagttt
   13701  aagcgagtac tcaaagaaat acccgatcac tcgaaacgat atcgatgtcg
   13751  tctcatcacg tatggggatc gttgtttcga aagttttacg gggaagcgat
   13801  ttggaaagaa tacctctctg aatcaactcg aaatttcgat gaaagaaatg
   13851  tatcgttaga ccacactttg agttcgggtg tggtcgtccg taggcagagt
   13901  cttttgaatg cgcctcaagg gactttcgag aacgagttag cgctattgta
   13951  caattcggtg gtgattaacg attttgttga gttgactggt atgcccttga
   14001  agtctttgat gacaggtatc gaagaccgta aggtacctga cgaattaata
   14051  tccgttgacc cgcacgaagt cggatgtaga ttcacgttaa acgacgtgga
   14101  atcgtatcta atgagcaggg gtgaggattt cgctgatgta gcggcggtcg
   14151  agcattcgtg gtgtttgagc aactcttgtg gtagactatt aagttcgact
   14201  gagatagatg cttacaaaac cttggtgttt actaagaatt ttgatagtag
   14251  tgtatccgga gtgactacta agttagagat ttatctatcg tactgcatgt
   14301  cattgtacaa gaaacattgc atgaaagacg atgattattt taatcttatc
   14351  ttacctatgt ttaattgttt aatgaaagtg ctggcgtcgc ttggtttgtt
   14401  ttatgagaaa cataccgaca atccgctact gaccggaatg ctcatagagt
   14451  tttgcctaga aaataaggtg tattactcta cttttaaagt gaatttagac
   14501  aacgtcagat tgtttaagtc taaagtgttg cctgtggtgt taacggtttg
   14551  ggatatatcc gagcctgatg acccagtgga tgaaagggtg ctaattcctt
   14601  tcgaccctac ggatttcgtg ctcgatttac ctaaattgaa tatacacgat
   14651  acaatggtgg tggtgggtaa tcaaatcaga cagttagaat acgtagtcga
   14701  aagcgatgct ttagacgatc tatctcaaca cgttgattta cgtttagcag
   14751  cggacaatcc cgatctacgc gttggtctgc gttgggcagg gatgtttgtg
   14801  tactacggtg tttatcggtg tgctgttgat agagcggtgg aacgaccgac
   14851  gttgtttaga ttgccgcaga aactattgag tcaggatgaa ggcgaatcgt
   14901  gctcattaca catgagttcc gtcgaagctt tattcaatct ggtgcagaaa
   14951  gtgaacaagg acataaacgt tagacgtcag ttcatgggac gtcatagtga
   15001  agtggctttg cgactgtatc gcaacttagg tttgaggttt ccaccgatct
   15051  catcggttag gttaccggct catcacggtt atttatacgt cgatttttac
   15101  aaaagaatac ctgacggtgc tgttaccgcc gacgaactcg aaagtttacg
   15151  tcaattacgc tcatccgtgg acgttatgtg taaggacagg gtgtcaatca
   15201  cacctccacc attcaatcga cttagaagag gttcttctag aacatttaga
   15251  ggtcgaggcg cacgcggtgc gagctcgcgt catatgagca gagacgtggc
   15301  gacttccggg tttaatttac cttatcatgg caggttatac agtacttcct
   15351  aaaaccgatg acaaagaaat ggatcctgtg agtgccgccg tgcccggtaa
   15401  gtatccggat gtcatcgaaa agtttgtggc caataggtcc gtagatgcgt
   15451  taatagaagg cgttataagt aaattggata ccaattcaat atacgaagat
   15501  tccactgaaa agtttactgg tgaacacttg aaatacgtta tggttactat
   15551  ggacactttc ttattagaaa actacaaaac gaaaacggaa gatctgttgg
   15601  ttcacttaac tatgatccaa aagaggttat acactatatc cacgagcact
   15651  aaaaccaagt ttcgcgataa aggttgtatt agttacgtac aagggggttt
   15701  acgatataag ttgttggaca aagtagtttt tcctttcatt atatcgaaat
   15751  ttaccgacag ggagactcca aacgctctac gtaagtttgc ttgcactttc
   15801  gaggagttac acttgtgtat ggctaggtta agacctgact tatacgaaaa
   15851  taaaaggacg accagggctg ggactccaca tttaaagggc tacctatcag
   15901  ctgactttct ctcaggttct ctccctgggt actccgaaca tgaacgaggt
   15951  atcattcttc gagcgtccga gtctatgtta gctagacgtc aaggttacga
   16001  ggaggcgacc gagcttctta acctacgcga tttgggtaag tacttgtagt
   16051  tggtttgggg acggtaacat tatactatcc catgagcgct gctttaaggg
   16101  tcgttaattg acgactcttg atatatttac taggtctgaa ttatggacga
   16151  cgaaacaaag aaattgaaga acaaaaacaa ggaaacaaaa gaaggcgacg
   16201  atgttgttgc tgccgagtct tctttcagtt ccgtaaactt acacatcgat
   16251  ccgactttga taacgatgaa cgatgtgcgt cagttgagta cccaacagaa
   16301  cgctgctttg aacagagact tattccttac tttgaaaggg aagcatccta
   16351  acttacctga taaagataag gactttcaca tagctatgat gttgtatcgt
   16401  ttagcagtta agagttcatc attacaaagc gatgacgacg ccacgggtat
   16451  aacgtacact cgggagggtg ttgaagtgga tttgtctgac aaactttgga
   16501  ctgacgtcgt gtttaactct aagggtattg gtaatcgtac taacgccctt
   16551  cgagtttggg gtagaaccaa cgatgccctt tacttagctt tttgcagaca
   16601  gaatcgcaat ttgagttatg gcggacgtcc gctagacgca gggattccgg
   16651  ccgggtatca ttacttgtgt gcggatttct tgactggagc tggtttgact
   16701  gatttagaat gtgctgtgta catacaagct aaagaacaat tattgaagaa
   16751  gcgaggggct gatgatatcg tagttactaa tgtcaggcag cttgggaaat
   16801  tcaacacacg ttgatctgtt gcgttccgat tcccggtttc tatcgggatg
   16851  gtggagtttc atcgtgaacg tgggtgatat aatcgtccgg ttcgcgttac
   16901  acgttcctaa tgaagatatg ctgaatagtt tttcagctat atcgaattgt
   16951  acgattatag cggacggtag tgctttacta aaagataata ctgtggtcga
   17001  tcgtttagaa ggcatgaatc ctttggctta tttattaaaa ttagcgaaaa
   17051  cgactactac tatttgtttt actatgtcta ataaggttct ttttggtact
   17101  actaaatccg aaccacttag ttgtttagct atcacgtcgg atcgagtttt
   17151  attcaaagtt gttatgggta ctaacgttga cgattctcga tgcggctgca
   17201  gtatttggtt ttacaacaac ggtacgtttc aaaatggatt gatccgttgt
   17251  aataatctcg tcgctttgtt tagcgtgact tagacacgaa gtgactgttc
   17301  ggattcaatt actgcaatga gctttcggcg tttgtggtta aaggttatgg
   17351  ctgtagttac ggtattatgg tacggtaaag agccttccat tagtgaaggt
   17401  tacaatgctc tcatgaatga tgactttaag tttatcgata cgcattttac
   17451  aaacgtttct tatgctaaga aatgttacga tttggctaat ttcgatttag
   17501  actttctacg catcgttatc attcctttga gtgggggtac ggtgaatgaa
   17551  tcgcgtgctg atcgcactaa cgtttcagaa attgtcgagt cgcatgtgag
   17601  cgaccgagac aggatgagca tcttgttgcg taataagcgg atccaaattc
   17651  cttcgctctt accttgcgat aactagagtc tactcagtag tacgtctatt
   17701  agtataacgt attaagcact ttagtaaagg gttttgttta aatcaaacaa
   17751  tatgcgagct tactttagtg ttaatgatta cataagcctt ttggctaagg
   17801  tcagcgctgt tgtggaacgt ttatgcgatc ccagcgtacc tcttgcggaa
   17851  gtgatggacg aaattaatga ctttaactcg tttctcgctt tagtgcactc
   17901  tatgaagtca gacatgaacg gagaccatca ggatggccac cacgagatgg
   17951  gtgaacacaa gtctcggttg ttatgcaaca tagaggcgaa attacgagta
   18001  cttctcgaca tcataagacg tcggttcact cgcgacaagc tgctctgtac
   18051  tagcgcgaca gatgtcatgg gcttctttgt aatgaggtac atgagttcta
   18101  gccacaccag cttcgaatcc gtaatgagga cggagttgag gttggtggtt
   18151  aaggcggtac tgtcggattt atcccgcgcg cataaactgg attttagcga
   18201  gcgagctttt gcggcttatg gtatcctttt gcaaaagggt actgtgtcga
   18251  ccgtttgcgg tcagtttgac attaatttag tctctccatc ttgcgtgtag
   18301  gttaatacgc ttctcagaac gtgtggttgt attaactaac tttaattcga
   18351  acaaatatat tgtgaaagtc tgcgagttac gatggataat actagcggac
   18401  aaactttcgt ttctgtgaac ctttctgacg aaagcaacac agcgaccact
   18451  gacgtcaaac ccgtgagttc ggaagcggat cgcttggatt ttttacaaaa
   18501  aatgaatccc attattatcg atgctttgat acggaagaat agttatcagg
   18551  gcgctcgctt tcgcgcgaga ataataggag tgtgcgtgga ttgcggtaga
   18601  aaacacgata aggggttgaa gactgaacgt aagtgtaagg tcaacaatac
   18651  gcagtctcag aacgaggtgg cgcatatgtt aatgcacgac cccgttaagt
   18701  atttaaacaa aagaaaagct agagcctttt ctaatgcgga gatatttgcg
   18751  attgatttgg ttatgtacac caaggaaagg caattggcta ttgatttggc
   18801  cgctgaaagg gagaaaacga gactggctcg tagacacccg atgcgttctc
   18851  cggaagaaac tccggaacat tataaattcg gtaggactgc taaagcaatg
   18901  ttaccggaca tcaacgccgt agacgttggt gataacgagg aaacttcgtc
   18951  ggagtatcca gtgagtctga gtgtttctgg cggagttctc cgtgaacacc
   19001  acttcatctg attgaagtgg acggaataag ttcctcgcgg aactttgtgt
   19051  tgggttggta aagaccctta tgatggtgat atatcactag acaataaccg
   19101  gatgggtaaa gtctttaaaa tgatcgaggg gaaaattaac cgtatcctct
   19151  cgttggtcta agctcccaca gagtggtagt ggtctcaagt gaggcttaac
   19201  gtatgcgtga accaaagaag ttctccttag agtgtgtgtt gtttaccaac
   19251  acactgtccc tatggggggc caacataggt cca