Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS577, complete genome.

ACC No: KC517488

Dated: 2013-04-30 | Length: 19282 | CRC: -388664690

                
ID   KC517488; SV 1; linear; genomic RNA; STD; VRL; 19282 BP.
XX
AC   KC517488;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FS577, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19282
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19282
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19282
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus macrophylla"
FT                   /isolate="FS577"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: T36"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .106
FT   CDS             107. .9466
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30095.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIVVLHYFGSVRITKV
FT                   IRDKSADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGLPVINASGVVRPR
FT                   SVAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPRGTRSRLHRRVVR
FT                   RADTAPVESPQDKPTRRNSRLGKTSHLPYMGEAALDDILRWIEEVNPHPSMVAIPVPIT
FT                   FGTMPATAWCSRSEAAVLRCRLDYHAAETDFSTQEKHVRYVYNDVSSATNRPRTVSPRK
FT                   CGSIFPSKSKLGVEVPSGRDFHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVLMSDGVNTARLDVVAPAYYAYAKSLGARVRFLWESSDLDDAKV
FT                   RDGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGTSAHVLIGQVQVSIPGSIVKPSRSAVRRRNR
FT                   RMRRDGFLGSSGSSSSAGESTRCSDCSSPRGLPSPPVLKPSLGRIPSIDRRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGSNFDELCHAVCTYVKRYNSRKSFYTRFESGRDYLVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENQYAAVMMDVGTSWVPKGYVPDVDVVKRRRSRNRR
FT                   FPLSHRAVDQSVPALQSSPVEVASVSSDKPSSSQKASSPSSSSFNSTRSSDWVNVGLSH
FT                   RTTNKVREPRSAGHRRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSFLRILLARL
FT                   SGYRPLSDEFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIG
FT                   SGGLLGLDSYGFSESLKDGYCYIRHFAEVSLSMGRIFFRRDVNLGPFPYVFEVQHRLER
FT                   LYGKAALRYGVRGQYSAPRCFHCCYNDSPRPMASFNGYHKMGGEDNSLIITDTDRLRAV
FT                   GSAYEKVKRNIPDSLLVRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTRAY
FT                   PEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCR
FT                   PVYDVKDAHRRVVRHHQLSKVSLDQSDGVKQVGAVNTNSVCGNILGECYHASEAMVMVQ
FT                   VYDVPLRELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPIADRVVYC
FT                   FNNSAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISETKR
FT                   LRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFE
FT                   WTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAF
FT                   SGETSIFELVRFAISEKCRDLFLGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISEYS
FT                   ELDVPIDLPGFGGIVDGNETRLMEDGVKSALLRKAVQAEAQLSLKRGNTSEIVPCDDDD
FT                   DSNGDDSRVSHDSDGGSSSGGSSGGLRAGAAPSLFRCLLRKLGGGLCLAKKVLELLVKR
FT                   VVESFSRLKRKTARLTSFANLLLARLSCGFFDDTVFSAVWEIAINLTRIVDGVVKTKLG
FT                   CFRNLFRLIPKLYAGCKDVVKDVSNAYRSVVLFSAEVLGKSYSKLCQFCLEIFDIGLIE
FT                   VSARNLGLETCVSIALAIFDVLITFPLGSVSFPVVCARVFGALAMEVGSNFLFKQVFGK
FT                   PETLGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEDDAWVG
FT                   YSKHEVSSLPIVTFCVKRLSYSLERCKEACVAFIVDSAKKILKSLTSEFNESIQNSDLT
FT                   SGAKSLYGHVSSILSTSSGVINRAGSAVATVKAVGSDISGRVKRMRPRFSLSRHFDEQT
FT                   SEYYSASDCSELDESLFSETPGLRGNGRCRDLFRIVSRRAVACCEYVTILLKRLASRAG
FT                   EYSYSYVMDTLVKLYVATDDVVRRCRSFTFDCTDKASNFVTGFLSWRSLRSGAYSATPG
FT                   LGGGSRGLTSFSHTGGFTRVIGALGNTLSVVFDEEFFRTLLHRLRTDVVVLLVEFLKNL
FT                   PVCLFSIYTFFECRGRIFPLREFLWGFCRFVWDVIEGLSINAYQYLSAVAEKVCRGAFN
FT                   RRFNEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEVSSSRSSDSPSFPPTYGEI
FT                   EELNDDSSDSALVIGVDNGTGRTIVDGETDSASGSDSDVSIPLDRDFEQIGGLGGNGNV
FT                   DVVRLGLKFVLKLLRNLFGARSFKVLYGLLLQTLFYGGSVNKFVCRLVFSLGTCLPFEL
FT                   LRFACSARRLLKSLASFVYQTNLFSEVMVEHLFSVSRLLYDSRHFATVFSELERLNFYL
FT                   DYFLSLPKRYLFPNSRDRSCARVPVPVIRTEGVAPVCERSLNDILDTLDSLKVSDLKGK
FT                   STFVDDGESDSGSEHSGSSISFGSVNEEVLNAVNGDGVCEKAPLMKHVTALSRLEPDPS
FT                   GRKDIPVSRKTFVRGESSGVKSKVSMCDYLVTLNSSFGTVPDMYPVARDITYKKLTNAM
FT                   REFYYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGS
FT                   HPFRNTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNE
FT                   EHSLIVYEAPPGGGKTHSLVNCYADYCVKVSCLVVTANKNSQTEISQRISNELMGRKLA
FT                   AKYVTDAASRVFTVDSYLMNHLRLTTQLLFIDECFMVHAGAIGAVVEFTSCKAVVFFGD
FT                   SKQIHYIHRNDLGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICEWLSEFYPRHVATANV
FT                   GSIGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRNKVVPIVNTV
FT                   HEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNID
FT                   RAKEIFDKFRSSNHSYGSSSLEWYLEKYPTEYKGSKASSAPISCINEFLNEVVVGSSVV
FT                   QLGDVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVTARKP
FT                   SVVRKS"
FT   CDS             <9339. .10841
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30096.1"
FT                   /translation="ETPPLLIRVTYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPSEFGRAMAAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIK
FT                   AVEAELKLPFSVEEQISNFKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPC
FT                   FDEFKNRVLSSLNDNIVFFTEMTNAGLAEIIRRIIGDDDNLFVGEVDFSKFDKSQDLFI
FT                   KEYERTLYSEFGFDTELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFDLLLVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQNKLTDVELFELFTSFKDITQDFGDQVVLEKLK
FT                   LLVEAKYGFTSGTTMPALCAIHCVRSNFLSFERLFPFIRGWYVVDALKLRQLRKLTNLI
FT                   CERVVYDNRVSYFSYFDNPFTKPDANDDNVDDLGQAGELATG"
FT   CDS             10890. .11801
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30097.1"
FT                   /translation="MFAFASESQDLLEEKVFRRRTYHRKYFGDVVKDFTIDIGYDTTDR
FT                   DPTVLADYFSLYFFLLNNDSVGPIAASIVVSPPVSGTHKIRAHIDNQPNCEGNVTYVKT
FT                   FDKSRFVIRVKAVPASMRGYYSFRVFLSSDVASERSEFVCSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFFFRAVSETATNEFSVATDDVEDVKYIRKQAEGFSRCADPYPPRCYRSTNLG
FT                   DSSGVQSRTIEEEGYMTGTAGNVAVTVPNTPLVSAVSPYVAEYNENARSRVSLIRRVCC
FT                   YAVCVLVVSVLIMSGLLAIIFI"
FT   CDS             11875. .12030
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30098.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRSASPY
FT                   GTHATV"
FT   CDS             12036. .13820
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30099.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATPSELVILKQSNSSYIPTCLFLHAEPN
FT                   SVSYGYDAEYLAASGESGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVIVKEFGTKSVP
FT                   VPYLSPLNNDLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLNSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFVPQKELNVSSLKEALSLQTDPVKYTVNHYG
FT                   MSETVSIDQTVLREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDA
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWS
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSRYDYAGMPHPTRKLVRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13744. .15351
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30100.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLMSRGEDFADLAAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSSVSGVTTKLEIYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPMDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDLRLAADNPD
FT                   LRVGLRWAGMFVYYGVYRCAVDRAVERPTLFRLPQKLLSQDEGESCSLHMSSVEALFNL
FT                   VQKVNKDINVRRQFMGRHSEVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRIPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYSTS"
FT   CDS             15326. .16048
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30101.1"
FT                   /translation="MAGYTVLPKTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLYTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLLDKVVFPFIISKFTDRETPNALRKFACTFEELHL
FT                   CMARLRPDLYENKRTTRAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16142. .16813
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30102.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFSSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKHPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADDIVVTNVRQLGKFNT
FT                   R"
FT   CDS             16779. .17282
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30103.1"
FT                   /translation="MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNLVTL
FT                   FSVT"
FT   CDS             17316. .17675
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30104.1"
FT                   /translation="MSFRRLWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFT
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRADRTNVSEIVESHVSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17751. .18299
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30105.1"
FT                   /translation="MRAYFSVNDYISLLAKVSAVVERLCDPSVPLAEVMDETNDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELRLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSSV"
FT   CDS             18381. .19010
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30106.1"
FT                   /translation="MDNTSGQTFVSVNLSDESNTATTDVKPVSSEADRLDFLQKMNPII
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKGLKTERKCKINNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEIFAIDLVMYTKERQLAIDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGRTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           19011. .19282
XX
SQ   Sequence 19282 BP; 4690 A; 3849 C; 4870 G; 5873 T; 0 other;

kc517488 Length: 19282  30-APR-2013  Type: N  Check: 434  ..

       1  atttcacaaa ttcaacctgt tcgcccagaa aatacgtctg gcacaacagg
      51  gatccggaat aggtccagcc tttaagctct aatattccca caacaaaaat
     101  tacactatgt cgaaactcag aggaagcttc tggtcttcgg ccatcgctgt
     151  taacagcgat tacacgatat cgcgcatctg gcgcaaactt aacaccatag
     201  tagtcctgca ctactttggt tctgttagaa tcaccaaggt gattcgtgac
     251  aaatcggctg atatgccgat agtcccttta cggaaatctg tatttccgtt
     301  ttctgttcgc gcggctgtcc gcgcaattcg tgctgctggg cgtcctcttg
     351  acgctccgca ttcagggtgc ctctgtggcc ttcccgttat caacgcatct
     401  ggcgttgttc gtccccgctc tgtcgcgggt ttttcgaggt tttctctgtg
     451  caaacctccg ctcacctctg ccgctaagag gtccctccgc caggcaaagc
     501  gggaatctgt ttccctttct agccgggcct cttctcgctt ctctagggaa
     551  gtccctcgcg gcacacgttc aagacttcac agacgtgtgg tgagacgagc
     601  tgacactgcc ccagttgaga gtccccaaga caagcctacc cgacgaaaca
     651  gccgacttgg taagacttct cacctccctt acatggggga ggcagcgttg
     701  gatgatatcc ttcgctggat tgaagaggtt aatcctcatc cctcgatggt
     751  cgctattcca gtgcccatca cttttggaac catgcctgca acggcttggt
     801  gttcccgctc tgaagccgca gttttgcggt gccgccttga ctatcacgcg
     851  gctgaaactg atttctccac tcaggagaaa cacgtacggt acgtctataa
     901  tgacgtatct tctgccacta accgtccccg tacggtttct ccccgcaagt
     951  gcgggtccat ttttcccagt aaatctaaac tgggcgttga ggtcccctct
    1001  ggtagggact ttcacactgc gttcgtgaga tcttctcacg cgagcgcttt
    1051  cttctctgac gcggttcgcc gcgttcgttt gttccgtcca gcgcggaaca
    1101  attttttcac ttccgtcgtc agcggacgac gtgtttgcta ttacagaccc
    1151  ggtccgtgtg gtacggtgtc tgttttaatg tcggacggtg ttaacacagc
    1201  acgtctcgac gttgtcgctc cggcgtacta tgcgtacgct aaatctttgg
    1251  gcgccagagt gcgctttttg tgggagtcgt ccgacttgga cgacgctaaa
    1301  gttcgtgacg gtcaatgtta tgtccgtcat gtgttcgacg tggctctcta
    1351  ctttgggaga cgcgccgacc tttccgtgcg tagagcactg ggtatgtacc
    1401  ccacagtggg tgcactaaag gcttatcttg ttcgcgaata cggtcgcgac
    1451  tctcttaagg ttcctatgcg tgggacctac acttttggca gtgtgtttca
    1501  ctgcttgtcg actaaatctt cagtcgacct gcgatctatt cctaaccatc
    1551  atttagttgg tgggacgtct gcccacgtct taattgggca ggttcaagtc
    1601  agtattcctg gctcgattgt taaaccttca cgttcggccg ttcgtaggcg
    1651  taatagacgc atgcgacgtg atggttttct cggtagttcc ggttcttctt
    1701  cttctgcggg ggagtcgact cgctgttcgg actgctcttc tcctcgcggt
    1751  ttaccttctc ctcccgtttt aaaaccttcc ctaggtcgga tcccgagtat
    1801  agatcggcgg ttccggtttc ctgcgggtac gcagttgcgc gtctccgtac
    1851  ctaggcgggt cgatgaccat gtttacgtgt cgactggtag caacttcgat
    1901  gagttgtgcc atgcagtttg cacgtatgtc aaaaggtaca actctaggaa
    1951  atccttttac actcgattcg agagcggaag ggactacttg gttttgcggc
    2001  gtgcttccgt tgggggtctt cacgtgtttg taaagcgtgg caactttact
    2051  gcccgatttc ctatttcggc ggtcaggtat gagaatcagt atgccgcggt
    2101  tatgatggat gtggggacta gttgggttcc gaagggctac gttcccgatg
    2151  ttgatgttgt gaaacgtcgg agaagtcgta atcgtcgttt tcctctttcc
    2201  catcgcgcgg tggatcagtc ggtccccgcg ttacagtcga gtcctgtcga
    2251  ggttgcttcg gtttcgagtg ataagccttc atcgtcgcag aaggcttctt
    2301  caccttcttc ttcttctttt aactcgacaa ggagttcaga ctgggtgaat
    2351  gtcggtttgt ctcatcgaac tactaataag gttcgtgaac cgcgttctgc
    2401  tggtcatcgt aggatcggaa attttacttt cccgaggggc acagtgtaca
    2451  acacgcctgt cgatgagcgc gcctataaac gtgttcttag attgcgagat
    2501  accacagcct gttcctttct ccgtatactg ctagctcgtt tgtcgggtta
    2551  cagaccttta agtgacgagt tctttaacaa gtgtgtcact tcccggtttg
    2601  tcgcgtgcat tgaacctgtg gaatcaggtc tcgttaaggt gcattttcgt
    2651  tctgatgttt ttcgtgcctc tttcccgttt ggggtcaacc tatacacccg
    2701  ccacgcgttt gacattggaa gtggtggtct cttgggattg gatagttacg
    2751  gcttttcaga atccttgaag gatggatatt gctacattcg ccatttcgcc
    2801  gaagttagtt tgagcatggg gcgaattttc ttcaggaggg acgtcaactt
    2851  gggacctttc ccatacgttt tcgaagtgca acaccgtctt gaaaggttgt
    2901  acgggaaagc tgcgttaaga tacggtgtta ggggtcaata ttcagccccg
    2951  cgctgttttc actgttgtta caacgattca ccgagaccga tggcgtcctt
    3001  taatgggtac cataagatgg gtggtgaaga taactccctg ataatcacag
    3051  acaccgacag gttgcgtgct gtggggagtg cctatgaaaa agtgaagaga
    3101  aacataccag attcgttatt ggttcggtct gtagaaaagg accttataga
    3151  gtttaatcag actctagtcg acatgcatcg atccagaccg ggcgttgtcg
    3201  tacctttcca aatgagtgag aatcagcaag tgatgcttac tagggcgtac
    3251  ccggaattta atattaattt tattcattcc gtacattccg atcatccggt
    3301  ggccgcaggt tctagggcgt tggagaatca tctcgttcgt aaacacgctg
    3351  gtaccgatta ttcggatgtg gggggttgtc cgctgtttca tttacgtgcg
    3401  ggtcactccg gcgttcacgt ttgtagaccg gtgtacgatg ttaaagacgc
    3451  tcatcgtaga gtagtccgtc atcaccaact tagtaaggtt tcgctagatc
    3501  agagtgacgg tgttaaacaa gttggtgctg taaacacgaa ttctgtatgc
    3551  ggtaacattt tgggagagtg ttatcatgca tcggaggcga tggttatggt
    3601  tcaagtttat gacgtaccgc tacgtgagtt gtgtagggct atgataaaca
    3651  agaaaacttc cgtgtgttat atgaccatgg ttacacctgg tgagttgttg
    3701  gacgcccgcg agtccttttt tattaaggac ttggattgtt cggttgagtt
    3751  agatcccatt gcagacaggg ttgtttactg tttcaacaat tctgcgtata
    3801  cacacacgta ctccactata tgtgagtata tgcgaactcc ttgcttggta
    3851  gtggacgggt ttttgtttac tatcgaaatg gtatcgctca ggtgtagcgt
    3901  taattactat tgtatcacca agtcgtcggt ctgtccgaga attagtgaga
    3951  ctaagcggtt gcgctaccgt cggtgtgata gcgacttgat tagaatcaaa
    4001  attccccggt actccagtaa gactcgtagt tgtttacctg ggtgttacta
    4051  tttgtacttg gacgccaagt ttgtaagtcg cgtgtacgag tacgtggtca
    4101  ataactgcgt tgtggtgaac gcgaaaactt ttgagtggac ttggaattac
    4151  atcaaatctt gcaagtcgag agtggtgatc agcgggaaga ttatacaccg
    4201  agacgttcca atcgctttag agtacttaga tgggttttct gcggttatgc
    4251  tgtccgctgg tgtgaagggt aggcaaaacg cggaagcgtt ttctagacgc
    4301  ttagccgctt tttcgggtga aacttcgatt ttcgagttag tgaggtttgc
    4351  tatatccgag aagtgccgcg acttgttctt gggtattcag gatgctgtgg
    4401  aaagatgcgt gaagtcgtac ctcaggaatt cgtttaatat gagtttcgtg
    4451  gacttgtccg accccttact tacgattagc gaatattcag aattggacgt
    4501  tcctatcgac ttaccgggtt tcggtggaat agtggacggt aacgaaacta
    4551  gacttatgga agacggtgtt aaatcggctt tattgcgtaa agcggttcaa
    4601  gccgaggctc agttgagtct taagagaggc aatacttccg aaatcgttcc
    4651  gtgtgatgac gatgacgact ctaacggtga tgattcgcgt gtttcgcacg
    4701  attcggatgg tggttcgtct tcgggtggta gttctggcgg gttgcgagct
    4751  ggagccgccc cttctttgtt taggtgttta ctcaggaaat tgggtggggg
    4801  tttatgtttg gcaaagaaag tgttggaact gttagtcaag cgggtggttg
    4851  aatcgttttc tcgtttgaag cggaaaaccg ctcgtttaac gtccttcgct
    4901  aatttgttgc ttgcgaggct ctcttgcggg tttttcgatg atactgtttt
    4951  ttctgcggtc tgggaaatag cgatcaacct gaccaggatc gtcgatggag
    5001  tagtcaagac aaaactgggg tgctttcgta atttatttcg attgattccc
    5051  aagttatacg ctggttgtaa ggacgttgtg aaggacgtta gtaacgctta
    5101  caggtcggtt gtcttgtttt ccgctgaggt tttgggtaag agttactcta
    5151  aactttgtca gttttgcttg gaaatatttg acatcgggct tattgaggtt
    5201  tctgctcgta atttgggact ggaaacatgc gtttcaatag cactagctat
    5251  ttttgatgtg ttgattactt ttcctttggg gagcgttagt tttcccgtcg
    5301  tttgcgctag ggttttcggt gctctcgcta tggaagtggg atcgaacttt
    5351  ttgtttaagc aagttttcgg taaacccgaa actcttggtg aagatgcttt
    5401  ccgtaggact gtgagtatgg ttttgagcgc caaagcgttt gacaagcttt
    5451  ccgtggatgc gaaaggttta gttaggtgct ctggtgttat tcctggagtg
    5501  ttaaggataa tactatcttc cttgttttcc gaagatgacg cttgggtggg
    5551  ttatagtaaa catgaagttt cttcccttcc tattgttacc ttttgtgtga
    5601  agagattgtc ttattctctg gagcggtgta aggaagcgtg tgtcgcattt
    5651  attgttgact ctgctaagaa gattttgaaa tctttaactt cagagttcaa
    5701  cgaatccatt caaaactccg acttgaccag tggtgctaag tccttgtacg
    5751  ggcacgtgag ctcgatactt tccacctcta gtggtgtgat taatagagca
    5801  ggaagcgccg tcgctactgt taaagcggtc gggagtgata tcagtggtcg
    5851  tgtgaaacgt atgcgacccc gattttctct gtcccgtcac tttgacgagc
    5901  agactagtga gtactactct gctagcgatt gttccgaact agatgagtcg
    5951  ttgtttagtg aaacgcctgg tcttcgtgga aacgggaggt gtagagattt
    6001  gtttcgtatc gtgtctagac gcgcggtagc gtgttgtgaa tacgtgacaa
    6051  ttcttttgaa acggctagcg tcgcgtgccg gtgaatactc ctactcgtat
    6101  gtgatggata cgctcgtgaa attgtatgtg gcgaccgatg atgttgttag
    6151  acggtgcagg tcctttacgt tcgactgtac tgataaagca tctaatttcg
    6201  tcaccgggtt tctcagttgg cgcagcttac gttctggtgc gtactctgca
    6251  actccagggt tgggtggtgg tagtagaggt ttaacgtcgt tttctcacac
    6301  cggtggattc acgcgcgtta tcggcgctct tgggaacacc ttatcagtgg
    6351  tgtttgatga ggaattcttc agaactttgc tgcatcggtt gaggacagat
    6401  gttgtggttt tactggtgga gttcttgaaa aaccttcccg tttgtttgtt
    6451  ttcaatatac actttttttg aatgtcgggg taggatcttt cctttaagag
    6501  agttcctatg gggtttttgt cgtttcgttt gggacgttat cgaggggttg
    6551  tccatcaatg cttatcaata cctctctgct gtcgctgaga aagtgtgtcg
    6601  aggtgccttt aatcgtcgat ttaacgaaga ggatgagagg acgcttcgag
    6651  tgatcacgga agcagaggga agaatcgaat ttttgcgagt tgttctcgcg
    6701  gaaatggaaa ggttccgtgc tgcgtcgaac gaggtttctt cgtcgaggtc
    6751  gtctgatagt ccttcattcc cacctactta cggtgaaatt gaggagttaa
    6801  atgatgattc ctccgatagt gcgctagtga taggcgtcga caacggtacc
    6851  ggccgcacta tcgttgacgg tgagaccgat tctgcgtccg gtagcgatag
    6901  tgacgtttct atcccgttgg atcgcgattt tgaacaaatc gggggtcttg
    6951  gtggaaatgg taacgtcgat gtcgttcggc tgggtttgaa attcgttctg
    7001  aagttgttac gcaacctatt cggtgctaga agttttaaag tgttgtatgg
    7051  gttgttactt caaacccttt tttatggtgg ttcggtaaat aaatttgtgt
    7101  gtcgtctggt ctttagtctt gggacttgct tacctttcga gttactccga
    7151  tttgcgtgtt cagcgaggcg gttgttgaag agtttggcat catttgttta
    7201  ccagactaac cttttcagcg aagttatggt ggagcatttg tttagcgttt
    7251  cccgactgct ttatgattcc cggcacttcg cgactgtgtt ttcggaattg
    7301  gagagactta acttctattt agactatttc ctttcgctcc cgaagagata
    7351  tctattccct aattctaggg atcgtagttg tgctagggtt ccggttcccg
    7401  tgattaggac cgaaggagtg gcaccagtct gtgagagatc actaaatgac
    7451  atattggaca ctttagactc tttaaaggtg tcggacctca aagggaagtc
    7501  gacgttcgtt gatgatgggg agtcggattc cggtagtgaa cattcgggta
    7551  gttcgatttc gttcggttcc gtcaacgaag aagttttaaa tgcggtaaat
    7601  ggtgacggcg tttgcgaaaa agccccgttg atgaagcatg ttaccgcact
    7651  tagcaggttg gaacccgacc ctagtggtcg taaagacatt cctgtttcta
    7701  ggaaaacttt tgtgcgtggt gaatcttcgg gtgtgaaatc gaaggtgagt
    7751  atgtgcgatt acttggtgac cttgaattct tcgtttggca cagtgcctga
    7801  catgtaccct gttgcgcgtg acataacgta taagaaactg actaacgcca
    7851  tgcgcgaatt ctattactcg caaaaaataa ccttgtacga acttcacggg
    7901  aagttgagtt cctattggga cgagttgaag gtcgcaggtt tcgatagaaa
    7951  gttaacgaga atggatttgg acgatgatgt ctatgttgtt gactttaatc
    8001  ggaaattgtt ggtggggaga aacggatctc atccgtttcg taatacgtta
    8051  aagtcctatt gttttatgtt ttgtaacgat gggttggttc cttgcccggg
    8101  ttctcagaaa tatgattatg ctttgatttc taatcaaacg tcttttgttg
    8151  ccgcgaattc gttcttacgt gccgtggatg gtaaggattt gacttttacc
    8201  aatgaggaac atagccttat cgtttatgaa gctcctcccg gtggtggtaa
    8251  gactcattct ttggtgaatt gctacgcgga ttattgcgtt aaagtatctt
    8301  gtttagtagt gaccgctaac aagaattctc aaaccgagat atctcagcgt
    8351  atatctaatg aattgatggg caggaagcta gctgctaagt atgttaccga
    8401  tgcagcttcc agagtgttca ctgtagattc ttacttaatg aatcacttgc
    8451  gacttacgac tcaactgctg tttatcgacg agtgctttat ggttcatgct
    8501  ggggcaattg gagccgtggt tgagttcacg tcttgtaaag cggtggtttt
    8551  ctttggtgat agtaagcaaa tccattacat tcaccgaaac gatctcgggg
    8601  tttctttgtt gcatgatatt gatgcgttta ttcaaccgga acatcgtatt
    8651  tacggcgaag tgtcctatag atgtccttgg gacatttgcg agtggctttc
    8701  cgagttttac ccgcgacacg tagctactgc taatgtaggg agtattggga
    8751  agtcgagtgt gtcaatagag gaaatcaatg ggtgcgatga cgtaccttac
    8801  gacaaggcgg cgaagtacat tgtgtacact caggctgaaa agaacgattt
    8851  gcaaaaacac ctcggtcgct taaccgtggg tcggaacaag gtagtaccaa
    8901  ttgtaaatac cgttcatgag gtacaaggag agacctataa aagggtacgt
    8951  ctggtgaggt ttaagtatca ggaggatacc ccgttctctt caaagaatca
    9001  tattgtggtt gctttgacta gacatgttga ttctttggtt tattccgtac
    9051  ttactagtag gaggtacgac gatactgcga ctaacataga tagggcgaag
    9101  gaaatttttg acaaatttcg ttcgtcgaat cactcgtacg gttcgtcatc
    9151  gttagagtgg taccttgaaa agtatcctac cgaatataag ggtagtaaag
    9201  catcctctgc tccgataagt tgcattaacg aattccttaa tgaggtcgtc
    9251  gttggttctt ctgtcgtgca gttgggtgat gtgtctgaag aactaagttc
    9301  acgtcccttt gaatcgggtt gtgataatgt tactgtaaga gacaccgccc
    9351  ctcctgattc gggtaactta cacgaaccgg ctcgcgttcg gcgtagtaag
    9401  gtcacaagca attcctccaa gaaaagcgtc actgcaagaa aaccttctgt
    9451  cgtacgaaag tcgtaattat aactttatca agacggaacg gtttgttgga
    9501  ccaagcgaat ttggtagggc gatggctgct gctgttatcg aacgttgttt
    9551  caaaatggaa gagatggcta agataaggtg tgatattata tcccttactg
    9601  aagctaacat tttaaaatgg ctcgataagc gaactccctg tcaaataaag
    9651  gccgtagagg cggagttgaa acttcccttt tcggtggagg agcaaatttc
    9701  caacttcaaa ctgatggtta aacgtgatgc taaggtaaaa cttgacgatt
    9751  caagtctatc taaacatccc gctgctcaga acatcatgtt tcataagaag
    9801  tttatcaatg ccatattttc cccgtgtttc gacgagttca aaaatagagt
    9851  gttgtcctcg cttaatgaca atatcgtgtt ctttactgag atgacgaacg
    9901  ctgggttagc ggaaattatc agaagaatca ttggtgacga cgacaactta
    9951  tttgttgggg aagtggattt cagtaaattc gataagtctc aggatttgtt
   10001  cattaaagag tacgaacgta cgttgtattc cgagtttggg ttcgataccg
   10051  aacttctcga tgtgtggatg gaaggtgagt atcgcgctag agccaccacg
   10101  ctggatggtc agctgagttt ttcagttgat ggtcagcgtc gttctggagg
   10151  ttcaaacact tggattggga attccttggt tactctaggt atcctttcgt
   10201  tatattacga cgtttcgaag tttgacttac tcctcgtttc tggagacgat
   10251  tctttaattt attcgagtga aaagataagc aacttttctt ccgaaatttg
   10301  cttagaaaca ggttttgaga ctaagtttat gtctccgagc gtgccatatt
   10351  tttgctcaaa gtttgtggtt cagaccggta acaaaacgtg ttttgtgcct
   10401  gacccttata aattattagt aaagttgggg gctccacaaa ataagttaac
   10451  cgatgtcgag ttatttgagt tgttcacttc ttttaaggac attacgcagg
   10501  actttggtga tcaagtggtt ttggagaagc tgaagttgct agtcgaagct
   10551  aagtacggtt tcactagtgg gaccactatg ccagcattgt gcgctattca
   10601  ttgtgtgcga tcgaactttc tgtcctttga gaggttattt cctttcatta
   10651  ggggttggta tgttgttgac gctctaaaac tcagacagct taggaaactc
   10701  actaatttga tctgtgaacg tgtagtttac gacaatcggg tgagttattt
   10751  ttcgtacttc gataacccgt tcactaaacc tgacgctaac gacgataacg
   10801  tggacgacct cggacaagcg ggtgaattag caaccggctg atcgattgat
   10851  tagttctcgc tgagagctaa tgtgggtagt tgagtcggga tgtttgcctt
   10901  cgcgagcgaa agccaagact tgttagaaga aaaagttttt cgtcgtagaa
   10951  cttaccatcg taaatatttc ggtgacgtgg ttaaggactt cactatcgat
   11001  attggttatg atactaccga tcgcgatcct actgtattgg ccgattattt
   11051  ctcattgtat ttctttttac ttaacaacga tagtgttggg cctatagcag
   11101  cttcaattgt ggtaagccca ccggttagcg ggactcataa aattcgagcg
   11151  catatcgata atcaaccgaa ctgtgaaggt aacgtgactt acgttaaaac
   11201  cttcgacaaa agtcgctttg tgattcgcgt aaaagcggtc cccgcttcta
   11251  tgagaggtta ctactctttt cgggtgtttc ttagtagcga tgttgctagc
   11301  gaacgcagcg agttcgtgtg cagttttgtt ggtagcaggt ttctttgctg
   11351  ttgtacacaa acgatatctg aaaatttgag taaagtttgt tcatcttcct
   11401  tcttcttcag agcagtttca gaaaccgcga ccaacgaatt ttctgttgcg
   11451  actgatgatg tggaagacgt taagtacata agaaaacaag ccgagggttt
   11501  ttcacgttgc gctgacccat accctcctag gtgttatcgt agcactaatt
   11551  tgggcgattc ttcaggggtt cagagtcgta cgattgagga ggaaggttat
   11601  atgacgggca ctgcaggtaa cgtcgcagtc accgtcccga atactccact
   11651  agttagtgct gtctctccgt atgtcgcaga gtacaacgag aatgcacgct
   11701  cgcgcgtctc attaatacgc cgggtctgtt gttacgccgt ttgtgtttta
   11751  gtggtgtccg ttcttataat gagcggttta ttagccatta tatttatatg
   11801  atttagtgta gtaactcata aggtacaatc acttacttaa gactcgccgt
   11851  ttgactctgt ttaaacgggg tttaatggac tgcgtaattc aagggttttt
   11901  aactttccta gttggtatag ctgtgttttc tgcttttgcc ggactgatta
   11951  tcattgttat aacaatttat cggtgcacga ctaagcccgt cagaagcgct
   12001  tccccttacg gcactcacgc gactgtctaa gcggtatggt gcttttgggt
   12051  ttagacttcg gtaccacgtt ttcaacggtg gctatggcta caccttcaga
   12101  gttagttata ctcaaacaat ccaattcatc gtacatacct acgtgtttat
   12151  tcctgcatgc ggaacctaac agcgtatctt atggttacga tgcggaatat
   12201  ttagcggctt ctggggagtc tggttcgttt tacaaagatt tgaagcggtg
   12251  ggttggttgc actgcgaaga actaccaaac ctacttacac aaactatcac
   12301  cttcctataa ggtgatagtg aaagagtttg gaactaagag cgtgccggtg
   12351  ccatatttgt cacctctgaa taacgattta ggactcagcg tcgctttacc
   12401  ttcactgatc gcttcgtatg ccaaatccat tctgtcggat gcggaacgag
   12451  tgttcaatgt aagctgcact ggagttatat gttcggtacc tgctggttat
   12501  aacacgttac aacgagcttt tacacagcag agcatatcga tgtcgggtta
   12551  ctcttgtgtg tacattatta acgaaccttc agcagccgcg tactccactt
   12601  tacctaagtt gaattcggca gataagtatt tagccgttta cgacttcggc
   12651  ggtgggactt ttgatgtctc tatagttagc gttagattac ccactttcgc
   12701  cgttagaagt tcgggcggtg acatgaattt aggcggtaga gatatcgaca
   12751  aaaagttatc cgataaaata tacgaaatgg ctgattttgt gccgcaaaaa
   12801  gaattgaacg tttctagttt aaaggaagct ttatctcttc aaaccgatcc
   12851  ggtcaaatat actgtgaatc attacggaat gagtgagacc gtatcaattg
   12901  atcaaacggt gttgagggag atagcctcgg tgttcataaa tcgaacgata
   12951  gatatactta cgcaagttaa ggttaagtct agtatgcccg aatcgcaaag
   13001  tttgaagtta gtggtagtcg gtggaagctc gtacctacca gggttgttgg
   13051  acgctttggc aaccgtgcct tttgtgtctg ggatagtgcc ggtggaagac
   13101  gcaagaaccg ctgtcgccag agggtgcgct ttgtatagcg agtgcttaga
   13151  tggtaggtct aaggccctac taatagattg tattacgcat catttgtcgg
   13201  tcacgacgtt tagcgcggat tcggtcgttg ttgcagcggc cggtagtcca
   13251  attccttttg aaggtgaacg aaaactcacg ttacgcaaat gcgttagtac
   13301  gtctaactat caagcaagaa tgttcgaagg ggattacgaa aaagttttcc
   13351  gaaatgaacg tatatacgca gcttcggtat cattgtttac attaggagtt
   13401  aattggagtg tgcctaacga cgttgagatg actctcgtga ccaaagtgga
   13451  ctcgatgggt aaagtggaat tttaccttaa aggtccatct ggtgaactgg
   13501  ttaacgtgca aggtacttcg cgttacgatt atgctggtat gcctcacccc
   13551  actagaaagc tggtgaggct tagcgattac aatgtaaact ccgccgcttt
   13601  agttttagct ttgacattaa ctcgcgaaaa acgagaaaag ttccttttgc
   13651  gaacattatt tgacacttta ctagcggatt tacgaaagac agcaagttta
   13701  agcgagtact caaagaaata cccgatcact cgaaacgata tcgatgtcgt
   13751  ctcatcacgt atggggatcg ttgtttcgaa agttttacgg ggaagcgatt
   13801  tggaaagaat acctctctga atcaactcga aatttcgatg aaagaaatgt
   13851  atcgttagac cacactttga gttcgggtgt ggtcgtccgt aggcagagtc
   13901  ttttgaatgc gcctcaaggg actttcgaga acgagttagc gctattgtac
   13951  aattcggtgg tgattaacga ttttgttgag ttgactggta tgcccttgaa
   14001  gtctttgatg acaggtatcg aagaccgtaa ggtacctgac gaattaatat
   14051  ccgttgaccc gcacgaagtc ggatgtagat tcacgttaaa cgacgtggaa
   14101  tcgtatctaa tgagcagggg tgaggatttc gctgatctag cggcggtcga
   14151  gcattcgtgg tgtttgagca actcttgtgg tagactatta agttcgactg
   14201  agatagatgc ttacaaaacc ttggtgttta ctaagaattt tgatagtagt
   14251  gtatccggag tgactactaa gttagagatt tatctatcgt actgcatatc
   14301  attgtacaag aaacattgca tgaaagacga tgattatttt aatcttatct
   14351  tacctatgtt taattgttta atgaaagtgc tggcgtcgct tggtttgttt
   14401  tatgagaaac ataccgacaa tccgctactg accggaatgc tcatagagtt
   14451  ttgcctagaa aataaggtgt attactctac ttttaaagtg aatttagaca
   14501  acgtcagatt gtttaagtct aaagtgttgc ctgtggtgtt aacggtttgg
   14551  gatatatccg agcctgatga cccagtggat gaaagggtgc tgattccttt
   14601  cgatcctatg gatttcgtgc tcgatttacc taaattgaat atacacgata
   14651  caatggtggt ggtgggtaat caaatcagac agttagaata cgtagtcgaa
   14701  agcgatgctt tagacgatct atctcaacac gttgatttac gtttagcagc
   14751  ggacaatccc gatctacgcg ttggtctgcg ttgggcaggg atgtttgtgt
   14801  actacggtgt ttatcggtgt gctgttgata gagcggtgga acgaccgacg
   14851  ttgtttagat tgccgcagaa actattgagt caggatgaag gcgaatcgtg
   14901  ctcattacac atgagttccg tcgaagcttt attcaatctg gtgcagaaag
   14951  tgaacaagga cataaacgtt agacgtcagt tcatgggacg tcatagtgaa
   15001  gtggctttgc gactgtatcg caacttaggt ttgaggtttc caccgatctc
   15051  atcggttagg ttaccggctc atcacggtta tttatacgtc gatttttaca
   15101  aaagaatacc tgacgatgct gttaccgccg acgaactcga aagtttacgt
   15151  caattacgct catccgtgga cgttatgtgt aaggacaggg tgtcaatcac
   15201  acctccacca ttcaatcgac ttagaagagg ttcttctaga acatttagag
   15251  gtcgaggcgc acgcggtgcg agctcgcgtc atatgagcag agacgtggcg
   15301  acttccgggt ttaatttacc ttatcatggc aggttataca gtacttccta
   15351  aaaccgatga caaagaaatg gatcctgtga gtgccgccgt gcccggtaag
   15401  tatccggatg tcattgaaaa gttcgtggcc aataggtccg tagatgcgtt
   15451  aatagaaggc gttataagta aattggatac caattcaata tacgaagatt
   15501  ccactgaaaa gtttactggt gaacacttga aatacgttat ggttactatg
   15551  gacactttct tattagaaaa ctacaaaacg aaaacggaag atctgttggt
   15601  tcacttaact atgatccaaa agaggttata cactatatcc acgagcacta
   15651  aaaccaagtt tcgcgataaa ggttgtatta gttacgtaca agggggttta
   15701  cgatataagt tgttggacaa agtagttttt cctttcatta tatcgaaatt
   15751  taccgacagg gagactccaa acgctctacg taagtttgct tgcactttcg
   15801  aggagttaca cttgtgtatg gctaggttaa gacccgactt atacgaaaat
   15851  aaaaggacga ccagggctgg gactccacat ttaaagggct acctatcagc
   15901  tgactttctc tcaggttctc tccctgggta ctccgaacat gaacgaggta
   15951  tcattcttcg agcgtccgag tctatgttag ctagacgtca aggttacgag
   16001  gaggcgaccg agcttcttaa cctacgcgat ttgggtaagt acttgtagtt
   16051  ggtttgggga cggtaacatt atactatccc atgagcgctg ctttaagggt
   16101  cgttaattga cgactcttga tatatttact aggtttgaat tatggacgac
   16151  gaaacaaaga aattgaagaa caaaaacaag gaaacaaaag aaggcgacga
   16201  tgttgttgct gccgagtctt ctttcagttc cgtaaactta cacatcgatc
   16251  cgactttgat aacgatgaac gatgtgcgtc agttgagtac ccaacagaac
   16301  gctgctttga acagagactt attccttact ttgaaaggga agcatcctaa
   16351  cttacctgat aaagataagg actttcacat agctatgatg ttgtatcgtt
   16401  tagcagttaa gagttcatca ttacaaagcg atgacgacgc cacgggtata
   16451  acgtacactc gggagggtgt tgaagtggat ttgtctgaca aactttggac
   16501  tgacgtcgtg tttaactcta agggtattgg taatcgtacc aacgcccttc
   16551  gagtttgggg tagaaccaac gatgcccttt acttagcttt ttgcagacag
   16601  aatcgcaatt tgagttatgg cgggcgtccg ctagacgcag ggattccggc
   16651  cgggtatcat tacttgtgtg cggatttctt gactggggct ggtttgactg
   16701  atttagaatg tgctgtgtac atacaagcta aagaacaatt attgaagaag
   16751  cgaggggctg atgatatcgt agttactaat gtcaggcagc ttgggaaatt
   16801  caacacacgt tgatctgttg cgttccgatt cccggtttct atcgggatgg
   16851  tggagtttca tcgtgaacgt gggtgatata atcgtccggt tcgcgttaca
   16901  cgttcctaat gaagatatgc tgaatagttt ttcagctata tcgaattgta
   16951  cgattatagc ggacggtagt gctttactaa aagataatac tgtggtcgat
   17001  cgtttagaag gcatgaatcc tttggcttat ttattaaaat tagcgaaaac
   17051  gactactact atttgtttta ctatgtctaa taaggttctt tttggtacta
   17101  ctaaatccga accacttagt tgtttagcta tcacgtcgga tcgagtttta
   17151  ttcaaagttg ttatgggtac taacgttgac gattctcgat gcggctgcag
   17201  tatttggttt tacaacaacg gtacgtttca aaatggattg atccgttgta
   17251  ataatctcgt cactttgttt agcgtgactt agacacgaag tgactgttcg
   17301  gattcaattg ctgcaatgag ctttcggcgc ttgtggttaa aggttatggc
   17351  tgtagttacg gtattatggt acggtaaaga gccttccatt agtgaaggtt
   17401  acaatgctct catgaatgat gactttaagt ttatcgatac gcattttaca
   17451  aacgtttctt acgctaagaa atgttacgat ttggctaatt tcgatttaga
   17501  ctttctacgc atcgttatca ttcctttgag tgggggtacg gtgaatgaat
   17551  cgcgtgctga tcgcactaac gtttcagaaa ttgtcgagtc gcatgtgagc
   17601  gaccgagaca ggatgagcat cttgttgcgt aataagcgga tccaaattcc
   17651  ttcgctctta ccttgcgata actagagtct actcagtagt acgtctatta
   17701  gtataacgta ttaagcactt tagtaaaggg ttttgtttaa atcaaacaat
   17751  atgcgagctt actttagtgt taatgattac ataagccttt tggctaaggt
   17801  cagcgctgtt gtggaacgtt tatgcgatcc cagcgtacct cttgcggaag
   17851  tgatggacga aactaatgac tttaactcgt ttctcgcttt agtgcactct
   17901  atgaagtcag acatgaacgg agaccatcag gatggccacc acgagatggg
   17951  tgaacacaag tctcggttgt tatgcaacat agaggcgaaa ttgcgagtac
   18001  ttctcgacat cataagacgt cggttcactc gcgacaagct gctctgtact
   18051  agcgcgacag atgtcatggg cttctttgta atgaggtaca tgagttctag
   18101  ccacaccagc ttcgaatccg taatgaggac ggagttgagg ttggtggtta
   18151  aggcggtact gtcggattta tcccgcgcgc ataaactgga ttttagcgag
   18201  cgagcttttg cggcttatgg tatccttttg caaaagggta ctgtgtcgac
   18251  cgtttgcggt cagtttgaca ttaatttagt ctctccatct agcgtgtagg
   18301  ttaatacgct tctcagaacg tgtggttgta ttaactaact ttaattcgaa
   18351  ccaatatatt gtgaaagtct gcgagttacg atggataata ctagcggaca
   18401  aactttcgtt tctgtgaacc tttctgacga aagcaacaca gcgaccactg
   18451  acgtcaaacc cgtgagttcg gaagcagatc gcttggattt tttacaaaaa
   18501  atgaatccca ttattatcga tgctttgata cggaagaata gttatcaggg
   18551  cgctcgcttt cgcgcgagaa taataggagt gtgcgtggat tgcggtagaa
   18601  aacacgataa ggggttgaag actgaacgta agtgtaagat caacaatacg
   18651  cagtctcaga acgaggtggc gcatatgtta atgcacgacc ccgttaagta
   18701  tttaaacaaa agaaaagcta gagccttttc taatgcggag atatttgcga
   18751  ttgatttggt tatgtacacc aaggaaaggc aattggccat tgatttggcc
   18801  gctgaaaggg agaaaacgag actggctcgt agacacccga tgcgttctcc
   18851  ggaagaaact ccggaatatt ataaattcgg taggactgct aaagcaatgt
   18901  taccggacat caacgccgta gacgttggtg ataacgagga aacttcgtcg
   18951  gagtatccag tgagtctgag tgtttctggc ggagttctcc gtgaacacca
   19001  cttcatctga ttgaagtgga cggaataagt tcctcgcgga actttgtgtt
   19051  gggttggtaa agacccttat gatggtgata tatcactaga caataaccgg
   19101  atgggtaaag tctttaaaat gatcgagggg aaaattaacc gtatcctctc
   19151  gttggtctaa gctcccacag agtggtagtg gtctcaagtg aggcttaacg
   19201  tatgcgtgaa ccaaagaagt tctccttaga gtgtgtgttg tttaccaaca
   19251  cactgtccct atggggggcc aacataggtc ca