Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FL278-T30, complete genome.

ACC No: KC517490

Dated: 2013-04-30 | Length: 19249 | CRC: -152784032

                
ID   KC517490; SV 1; linear; genomic RNA; STD; VRL; 19249 BP.
XX
AC   KC517490;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FL278-T30, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19249
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19249
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19249
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus paradisi"
FT                   /isolate="FL278-T30"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: T30"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .19249
FT   CDS             109. .9447
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30119.1"
FT                   /translation="MSKLGASFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVFDTSGVVRPR
FT                   SVAGAWRYALCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVAK
FT                   LVDPTVRESPQDKTKLKGRRYGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAVPVPIS
FT                   FGTLPTTAWCSEADAAVLRCRLDYHAAATSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRIFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKTLGARVRCLWESSDLDDAKV
FT                   RDGQCYIRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSVPNHHLVGGESAHLFVGQIRLDVRGGVSKPSRSAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSVVGPTLGRIPSVNRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGSFTARFPMSASRYEHHYDASMKGAGLSWVRKSQFPNVEVIRRRRSRASGS
FT                   SASFPDANLQVSSDRPSESVQVVPMLDEGSSPPRGVPSPRRNPVEGSGWYSVGSPSRRS
FT                   STTRGQRSAERGKIGDFSFPSGTVYNARVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGR
FT                   LLQLDSYGFSEDLRDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYSVRGYFSAPRLYHCCFTDSPRPFRFLNKYHRMGGEEGALLITDTDRLRAVGSV
FT                   YDKVKKALPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGIHVCRPVY
FT                   DVKDAHRRVVRHHQLGKVAFDHTDGSKQVGAVNTNTVCGNILGECFHASEAIVMVQVYD
FT                   VPLRELCRAMVNKKTSVCYMTMVTPGELLDARESFFIKELDCSVELDVVADRVVYCFNN
FT                   SAYTHAYSTIREYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEVKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKVIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAVSEKCRDLFVGIQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEEDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLG
FT                   SDGSDSSLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCVARRLLDLLCERLVG
FT                   SLSRLKFGTTHLTSFFSMLRAKLSCNFFDDSIFTAVWDTVMNLIRIVNGVTKTKLECFR
FT                   NVLRLIPKLCSGCKDFAKDFADMCKSVLLFSTEFFSKSYTKLCRFSLEIFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVILTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTLGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGIIPGVLRIVFSSLFSDADAWVGYSK
FT                   HEVSSLPMITYSAKRLSFVLEQTKEACIAFIVDSSKRILASLTSEIHESLQNSELTSGA
FT                   KSLYGRVSSILSASNGMVNKAGNAVAAVKAAGSGLSKRVKRIRPSFHLARCVNEQTSEY
FT                   YSASDDSELDESLLSDTPGLRGNGKCNDLFRVVSGRVLVYRVAALKRLVLHVGECLYSR
FT                   IADSFVRLFVRTNTAVGKCESLAVDCATKITDLVVGYITWRNLHFGAYSTTPGLSGGSR
FT                   VSLSRLLGDGLTCVIQNFVTAWLTIFNETFYSSLVHRMRTASINVLLEFLKNLPVCLVS
FT                   IYTFIECRSRIFPLKEFLWGFCIFVWNIIKELSVCIYENLPVCVTRLCNRAFRRSSNED
FT                   DERTLQVITEAENRIGFLREVLAEMARYRASLEIPVPGSPNSPLFPPTYGEIEELGDGS
FT                   SDSARVIGVDNGSDSMSTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFRLGL
FT                   RFVWRMSRNIFNLRAVKFSYGLALQCIFNGRSTGQFISRLLFSFGGCLPFEFFRHVCAV
FT                   RWLSRSLALHVRNASICDEETVEWLFSFSRFLYDSRYLSLVFSELERVEFYLSYLFSLP
FT                   KRCFTHNRSVQVCVRAPVRVVRDVGLVEDGRKSLSEVLNSLDSLKVSNRKGKSAVIESD
FT                   SSDSESGSSSGSISFGSINEEVLKTANGSVVSEKASLMKHAAALSGLEPDLGGKKDLPI
FT                   IRRNFTRGESSGTKSVGSLCEYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFYYSQ
FT                   KVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVGVVDFNLKVIVGRHGTRPFRNTV
FT                   NSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSLIVY
FT                   EAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHVIKT
FT                   AGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQIHYI
FT                   HRNDLGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSVGKSS
FT                   VSIEVINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPVVNTVHEVQGET
FT                   YKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEAREIFD
FT                   KFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGDTSE
FT                   ELSSRPFESGCDNVTIRDTAPPDSGNLHEPARVRRSKVAGNSAKKSVPTRKSSVVRKS"
FT   CDS             <9320. .10804
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30120.1"
FT                   /translation="GTLLPQTLVIYTNRLVFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPECFGRAMAAAVIERCFKMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   AVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSQHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDDLFIGEVDFSKFDKSQDLFI
FT                   KEYERALYFEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDNTQDFGDQVVLEKLK
FT                   LLVEIKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNTFTKPDASDGQMDDLMTG"
FT   CDS             10853. .11764
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30121.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKT
FT                   IDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11834. .11989
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30122.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             11995. .13779
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30123.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNNLGLSVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVLVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPTDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLSRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13703. .15310
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30124.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLKNKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPALFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             15285. .16007
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30125.1"
FT                   /translation="MAGYTTLPNTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLYTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16107. .16778
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30126.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16744. .17247
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30127.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAVTSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             17281. .17640
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30128.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17715. .18263
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30129.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18346. .18975
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30130.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEY
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18976. .19249
XX
SQ   Sequence 19249 BP; 4720 A; 3830 C; 4903 G; 5796 T; 0 other;

kc517490 Length: 19249  30-APR-2013  Type: N  Check: 2668  ..

       1  aatttcgatt caaattcacc cgtacctccg gagctcgatc cggaccctgc
      51  gggacttggt gtaaatccca accagacggt tgctctacgc ccataatatc
     101  aatacaacat gtcgaaactc ggagctagct tcaagtcctc gactttcgct
     151  gtacgcagcg attacataat ttcgcgcatc tggcgcgcct ttaataccgt
     201  tggagtcctg cacttcttcg gcactgatac aaccactacg gtggttaagg
     251  agttttcggc tgctgggccg atcgtccctt tacggaaatc ctgttttccg
     301  ttctcagttc gcgctgctgt tcgcgcgatt aaagctgccg gacgtcctat
     351  tgacgctccg cgctccggat gcctctgtgg cctccctgtt ttcgacacat
     401  ctggtgtcgt gcgtccccgc tctgttgcgg gcgcttggag gtatgctctg
     451  tgtaaacctc cccttactgc tgccgccaag aagtccattc gcaaggcgaa
     501  gaaagattct gcattctttc tcagccgggc ttcttctctc ttctctcggg
     551  aagtcccttg cggcacgcgt cacagacttc gcaggcgtgt tgcgaaacta
     601  gttgacccta ctgtgcgtga aagtccccaa gacaagacta aacttaaggg
     651  gcgccgatat ggcaaaaatt ctgacctccc gtatatgggg gaagcggcgt
     701  tggatgacat ccttcgctgg attgaggggg taaatcctcc gccgtcgatg
     751  gtcgccgttc cggtgcccat ctcttttggc actctgccca ctacggcttg
     801  gtgctctgag gccgacgccg ctgttctgcg gtgtcgctta gactatcacg
     851  ccgctgcgac ttcctttcgt aatgaaggga agcacgtgag atacgtctat
     901  aatgacgtgt cttccgctgc caaccgtcct cgtacggttt ctccccgcaa
     951  gtgcgggcgt atttttccca gcggttctgc gctgggtgtt gaggttccaa
    1001  gtactaggga ccgccacacc gctttcgtga gatctactca cgctagcgtt
    1051  ttcttttctg acgcggttcg ccgcgttcga atgttccgtc ctgggcggaa
    1101  taatttcttt actagcgtcg tcagtgggcg gcgcgttagt tactttagac
    1151  ccggacctaa cggtacggtg tctgttctaa tgtcggatgg cgtcaatacg
    1201  gcgcgtctcg acgttgtcgc tcccgcgtac tatgcgtacg caaaaacgtt
    1251  gggcgccaga gtgcgctgtt tgtgggagtc gtccgatttg gacgatgcta
    1301  aagtacgtga cggtcaatgc tacattcgtc acgtgtacga cgtggcccta
    1351  tattttggga ggcgcgtcga cctttctgtg cgccgcactt tgggtttatt
    1401  ccccacagtg ggtgcgttaa aggcttatct tgttcgcgag tatggtcgcg
    1451  actctttgaa ggttccgatg cgcgggactt acacttttgg cagtgtattt
    1501  cattgcctgt cgactaaatc ttctgtcgac ttaagatctg ttcctaacca
    1551  tcacttggtt ggtggtgagt ctgctcactt gtttgttggg cagattcgtc
    1601  ttgatgtccg tggtggcgtc tctaagccat cacggtcggc ggttcgcagg
    1651  cgtaatagac gtttgcgtga ggacggtttt ctaggtagta ccgattcatc
    1701  ttcttcagga gggtcgagat actgttcgga ttgttcgact cctcgcagtc
    1751  caccctctcc gtcggttgtt gggccaactc ttggtcggat accgagtgta
    1801  aaccggaaat tccggtttcc agcaggcact cagttgagcg tttctatccc
    1851  taaacgcgat gacgatcgcg tgtacgtgtc ggttggtcaa gactttgatg
    1901  agttgtgcca tgccgtgtgt acctacgtta agaggtacaa ttcgagaaaa
    1951  gcgttttaca cgcgttttga aaacggtgac gattttgctg tcattcggcg
    2001  tgcttccgtc ggaggtcttc acgtgttcgt gaaacgcggt agttttacgg
    2051  ctcgtttccc aatgtcggct tcaaggtatg agcatcatta tgatgcaagt
    2101  atgaaaggcg ccggtttgtc ctgggtgcgg aagagtcaat ttccgaacgt
    2151  tgaagttata cgccgtcgaa ggagccgggc aagcggttct tcggctagtt
    2201  ttccggacgc gaatttacag gttagttcag accgaccgtc ggagtctgtc
    2251  caagtggttc cgatgttgga tgagggttct tcaccacctc gaggagtgcc
    2301  ctcgccccga cgcaatcctg tcgaagggtc gggctggtat agcgtgggtt
    2351  ctcctagtcg gcgctcgagt actactcgtg ggcaacgttc cgctgaacgt
    2401  gggaagattg gggatttcag ttttccgagt ggcactgtgt acaacgcacg
    2451  cgtggacgag cgtgcttata aacgtgtctt aaagttgcgg gacacgtcgg
    2501  catcctcctt tcttcgtata gttcttgctc gtttgtcgag ttatcgacct
    2551  cttagtgacg aattctttaa caaatgcgtt acttctcgat ttgtagcttg
    2601  tatcgaggcg gttgaatcag gtctcgttac agtacacttt cgatcagacg
    2651  tgtttcgtgc ttctttccct tttggtgttt atttatacac tcgtcacgcg
    2701  tttgatattt acagtggtag gctcctgcaa ttagacagct acgggttttc
    2751  agaagaccta agagacggct actgttatat tcgtcacatt gctgaagtgt
    2801  gtttgagtat ggggaaggtt ttctttagga gggacgttaa cttaggggcg
    2851  ttcccttatg ttttcgaggt acagcaccgt cttgagcggt tgtatggtaa
    2901  gcgggctgtt gagtacagcg ttagaggtta tttttcagca ccgcgtcttt
    2951  accattgttg ctttaccgat tcgcctagac ccttcagatt tttaaataag
    3001  tatcatagga tgggtggcga agaaggtgcg ttgttgatta ctgacactga
    3051  cagattgcgt gccgtaggga gtgtttatga taaggttaag aaagctttgc
    3101  ccgattcttt actcgttcga tcagtagaga aagatttgat agaattcaat
    3151  caaactctgg tcgatacgca acgggctaga cccggtgttg cagtgccttt
    3201  tcagatgagt gagaaccaac aggtgatgct cactagagcc tatcctgagt
    3251  ttaatataaa ctttactcat tccgtacact ccgatcatcc cgtggctgcg
    3301  ggctccagaa tgttagagaa ccacctcgtt cgcaaatatg caggcagtga
    3351  ctattcggac gtaggtggtt gcccactatt tcatttgcgt gcaggccaca
    3401  caggaattca cgtttgcaga ccggtgtacg atgttaaaga cgcccaccgt
    3451  agagtcgttc gtcatcatca acttggtaaa gtagctttcg atcatactga
    3501  cgggtctaag caggttggtg ctgtcaatac gaatactgtg tgcggcaaca
    3551  ttttagggga gtgttttcat gcgtctgaag cgattgttat ggtgcaggtt
    3601  tacgatgtgc cactgcgaga gttgtgtaga gctatggtaa acaagaaaac
    3651  ttcggtgtgt tatatgacca tggtcacacc tggcgagttg ttggacgctc
    3701  gtgagtcctt cttcatcaaa gagttggact gttcggtaga gttggacgtt
    3751  gtcgccgata gggttgttta ctgctttaac aattcggcgt acacgcacgc
    3801  gtattctacg atacgcgaat acatgcgtac tccttgtgtg gtggtggatg
    3851  gttttctatt cactatagag atggtttcgc ttagatgcag cgttaattat
    3901  tattgcatca ccaaatcgcg ggtctgtccg agaattagcg aggttaaacg
    3951  actacgctat cgtcggtgtg atagcgactt gattaggatt aagattcctc
    4001  ggtactccag caagactcgt agttgtttac cggggtgtta ttatttgtac
    4051  ttggacgcta agttcgttag tcgcgtgtac gaatacgtag ttaataattg
    4101  tgttgtggtg aatgctaaga cttttgaatg gacttggaac tacatcaagt
    4151  cctgtaagtc gagagtggtc attagtggga aggtcatcca tagagatgtt
    4201  cctatagcgt tggagtattt ggatgggttt tccgcggtta tgttgtccgc
    4251  gggcgtgaaa ggtaggcaga acgcagaagc gttttctagg cgtctggctg
    4301  ccttttcagg agatacttct cttttcgaat tggtgaggtt tgccgtttca
    4351  gagaagtgtc gcgatttatt tgtgggcatt caggaggctg tggagaggtg
    4401  cgtgaaatca taccttagga actcgtttaa tatgagtttc gtagacttgt
    4451  cagatccttt gcttactatt agtgagtact cggagttaga tgttcctatc
    4501  gatttgccgg gtttcggctg cataacagaa gaggatgagg ctaaactcat
    4551  agaagatggg gttaagtcgg ctttgctacg aaaagcggtt cgtgacgagg
    4601  cgcaactcat tctcgaaagg ggtggtacgt cggagatcgt tccttgtggg
    4651  gatgatgatg gtttgggcag cgatggttct gacagttcac tcgggtcagg
    4701  tagtgattcg tcctctaaag ctagttctgg tggtttacgt gccggagccg
    4751  ccccttcact gtttagaagc ttactgaaga agttgggcgg gggtttttgt
    4801  gtggccagaa ggttattgga cttgttgtgc gagcgattag ttggttcgtt
    4851  gtcgcgccta aagttcggca ccactcattt aacctcattc tttagcatgt
    4901  tacgcgctaa gctttcgtgt aatttcttcg acgactcgat ttttaccgcc
    4951  gtttgggaca cggtaatgaa cttaattaga atcgttaacg gggtgaccaa
    5001  gacgaagttg gagtgttttc gcaacgtact tcggttaata cctaagttgt
    5051  gttctggttg taaagacttt gcgaaggact ttgcggacat gtgcaagtca
    5101  gttttgctat tttctacgga attcttcagt aaaagctata ctaaactgtg
    5151  tcggtttagt ttggaaatat tcgatgttgg acttattgaa atttcagccc
    5201  gtaatatggg actggagact tgtgtttcga tggcttcagc tatttttgat
    5251  gtcatactta cctatcctct gggaagtatt agctttcccg tcgtttgtgc
    5301  gagagttttt ggcgccctcg ctatggaagt gggatcgaac tattgcttta
    5351  agaaaactct cggcaaaccc gaaattttag gagaggatgc ttttcgtaga
    5401  acggtaagta tggtgttgag cgctaaggct ttcgacaaac tttcagtcga
    5451  tgctaagggt ttagttagat gttccggtat tattcctgga gtattgagga
    5501  tagtgttttc atctctgttt tccgatgctg acgcatgggt gggttatagc
    5551  aagcacgaag tttcctcact tcccatgatc acgtatagtg cgaaaaggtt
    5601  atctttcgtg ttggagcaga ctaaggaagc gtgcatcgct ttcatagtcg
    5651  attcgtctaa gagaatctta gcgtctttga cctcggagat tcacgagtct
    5701  ttgcaaaact cggaacttac tagtggtgct aaatccttgt atggacgtgt
    5751  gagttctata ctctcagcat ccaatggaat ggttaacaag gcaggaaacg
    5801  ccgtcgcagc agttaaggcg gcggggagtg gtcttagtaa acgtgtgaag
    5851  cgcattcgtc cttcctttca ccttgctcgg tgtgttaacg aacagaccag
    5901  cgaatactat tctgccagtg acgactctga gttggacgag tcgctgctta
    5951  gtgacacacc cggtcttcgt ggtaacggga agtgtaacga tttatttcgt
    6001  gtcgtttccg ggcgtgtctt agtatatcgc gtagcagcct tgaagcgttt
    6051  agtcctacac gtcggtgaat gcttgtactc gcgcattgcg gactctttcg
    6101  tgaggttgtt cgtaagaacc aatactgcag tcgggaagtg tgaatccttg
    6151  gctgtcgact gtgccacaaa aattactgat ttagtagtcg gatatatcac
    6201  ttggcgtaat cttcattttg gtgcgtattc gacaactcca gggttatctg
    6251  gcggtagtag agtttctctt tccaggctct tgggtgatgg tctcacgtgt
    6301  gtaattcaaa atttcgttac cgcgtggttg acgattttca atgagacctt
    6351  ttattcgagt ttggtccatc ggatgaggac tgcctcgata aatgtgttgt
    6401  tagagttcct gaagaacctc ccagtttgtt tagtttcgat atacactttc
    6451  atagagtgta gatctaggat ttttcctttg aaggagtttc tttggggctt
    6501  ttgcattttc gtctggaaca tcatcaaaga actttccgta tgtatttacg
    6551  aaaatcttcc cgtttgcgtt acgaggttgt gtaatagggc attccgtcgt
    6601  agttccaatg aagatgatga gcgcacgctt caagtaatca ctgaagctga
    6651  aaaccgaatt gggtttttgc gagaggttct cgccgaaatg gcacggtatc
    6701  gtgcgtctct cgagattccc gtgccggggt cgcctaacag tcctttgttt
    6751  ccaccgacat acggtgagat tgaggaacta ggtgacggtt cttctgatag
    6801  tgcccgagtg ataggtgtgg acaacggttc agactcaatg tccactgaag
    6851  gggaagcgga actagattcg gatggtgata gcgatgattc aatacctttg
    6901  gatcgtgact ttgagcagat cggaggtctt ggaggaagcg gcaacgtcga
    6951  cgtctttcgt ctagggttga ggttcgtgtg gagaatgtcg cgtaatatat
    7001  ttaacttaag agccgttaaa ttttcttatg gtttagctct tcagtgtata
    7051  tttaacggca gatcgacggg ccagtttata tcgcgactgt tattcagttt
    7101  cggcggctgt ttaccgtttg agttcttcag gcacgtttgt gctgtgaggt
    7151  ggttgtcaag gagcttggca ttacacgttc gtaacgctag tatctgcgac
    7201  gaagaaacgg ttgaatggct tttcagtttt tcgcgatttt tgtacgattc
    7251  gcgttattta tccctcgtgt tttcggagtt ggagagggtc gaattttact
    7301  taagttacct gttctcgttg ccgaagaggt gtttcacgca taaccgcagc
    7351  gttcaagttt gcgttagagc tccagttcgt gtggttaggg acgtgggact
    7401  tgtagaagat ggtaggaagt ctttatccga agtgttgaac tctttggact
    7451  ccttgaaggt gtctaaccgt aaagggaagt cagcggttat tgaaagtgat
    7501  agttccgatt ctgagagcgg tagctcgtcc ggttccatct cgttcggatc
    7551  gattaatgag gaagttttaa aaacggcgaa cggtagcgtt gtatctgaaa
    7601  aagcttcgtt gatgaagcat gcggccgcac taagcgggtt ggaaccagat
    7651  cttggtggta agaaagatct tcctattatt aggagaaatt tcacccgcgg
    7701  tgagtcttca ggtacaaaat cggtagggag cttgtgcgag tacttgacga
    7751  ccttaaattc ctcgttcggt tcggtgccgg acttgtatcc cgtcgcacgt
    7801  gacataacgt acaagaagat gaccaacgcc atgcgtgaat tctattattc
    7851  gcaaaaagta acgttgtatg aacttcatgg aaaattaagc tcgtactggg
    7901  acgagttaaa gacggtgggt ttcgacagga aattggcgaa gatggatttg
    7951  gacgatgacg ttggtgttgt cgattttaac ttgaaggtga tagtgggaag
    8001  gcatggtact cgtcctttca gaaatactgt gaattctcac gagttcatgt
    8051  tttgcgacga cggtttggtg ctttgcccgg gtccgaaaaa acgcgatttc
    8101  gctttgatct ctagtcaaac gcaattcgtt gctgcgaact catttctacg
    8151  tgctgtggac ggcaaagatt tgacgttcac taattcggag catagtctta
    8201  tagtttatga ggctcctccc ggtggtggga agacgcattc cttggtaacg
    8251  tatttcgccg attattgtac taaagtgtct tgcctagtgg tgaccgctaa
    8301  caagaattcg caagcggaga tttctcaaag gatctctaga gagttaatgg
    8351  atagaaaaat gcttgctaaa catgttatta aaaccgccgg tagagtgttc
    8401  accgtggact cttatttgat gaaccatatt cgacttaaga ctgacttgtt
    8451  gtttgtcgat gagtgtttta tggttcatgc tggagcaatc ggagcagttg
    8501  ttgaattcac ttcatgtaag gccgtggttt tcttcggtga tagtagacaa
    8551  attcattaca ttcaccggaa cgatcttggt gtttcgttgt tacatgacat
    8601  agacgcattt atagaaccac agcaccgcat ttacggtgag gtgtcttaca
    8651  ggtgtccttg ggacatctgt gagtggttgt ctaaattcta tccgagacat
    8701  gtagctactg ctaacactgg aagtgtcggg aaatcgagtg tgtctataga
    8751  ggtaataaat ggatgtgacg atgttcctta cgacagtagt gcgaagtata
    8801  tcgtttacac acaagcagaa aagaacgaac tgcaaaagca ccttggtcgt
    8851  ttaaccgtag gccgaactaa agcggtgcct gttgtgaaca cagtacatga
    8901  agttcaaggg gaaacgtata agaaggtccg tttggtaagg tgcaaatacc
    8951  aagaggacac tcctttctgt tcggataatc atgtcgttgt ggccttaacc
    9001  aggcatgtcg actccttaac ttactctgtt ttgaatagta ggagatacga
    9051  caagactgct tctagtatag atgaagcgag ggagattttt gacaaatttc
    9101  gttcgacgaa ccattctcac ggttcctcaa cgttagaatg gtacctcgaa
    9151  aagtatccta ctgaatataa gggtagcaaa gcatcttcgg caccgttaag
    9201  ttgtattaac gagtttctta acgaggtcgt tgtcggttct tcggttgtgc
    9251  agttgggaga cacttctgaa gaattgagtt ctcgcccttt tgagtccggg
    9301  tgtgacaatg ttaccataag ggacactgct cccccagact ctggtaattt
    9351  acacgaaccg gctcgtgttc ggcgtagtaa ggtcgcaggc aattccgcca
    9401  agaaaagcgt ccctacaaga aaatcttctg tcgtacgaaa gtcgtaatta
    9451  caactttata aagacagagc ggtttgtggg gcctgaatgt tttggcagag
    9501  ctatggctgc ggctgttatt gagaggtgtt ttaagatgga tgaagtggcc
    9551  aagataagaa gcgatattat tgccttaact gaagccaata ttcaaaaatg
    9601  gctcgataag cgtactccgt gtcaggtgaa agccgtgcag gctgaactga
    9651  agttaccgtt cgctgtggaa gagcaaatca ctaactacaa actaatggtt
    9701  aagcgtgacg ctaaagtgaa gctcgatgat tcgagtctgt cccagcatcc
    9751  tgccgcgcag aacattatgt ttcataagaa atttatcaac gctatttatt
    9801  ctccatgctt cgatgaattt aagaatagag tgttatcgtc actaaacggt
    9851  aatatagttt tctttactga gatgacgaac gctgggttgg cggaagttat
    9901  caggaggatt ataggcgatg acgacgacct tttcattggg gaagtggatt
    9951  tcagtaagtt cgacaagtct caagatttgt tcatcaagga gtatgagcgc
   10001  gcattatact ttgagttcgg gtttgatgac gaacttcttg acgtgtggat
   10051  ggaaggcgag taccgcgcta gggctactac gttagacggt cagctgagtt
   10101  tttcggtcga cggtcaacgc cgttcgggag gttcgaacac gtggattggg
   10151  aactctttgg ttaccctagg tatcctatct ttgtactacg acgtctcaaa
   10201  gttcgagcta ctactcattt ctggcgacga ctctctgatc tattcaaaag
   10251  aaaagattag taacttttct tcagaaattt gtctggagac aggttttgaa
   10301  actaagttta tgtctcctag cgtaccgtac ttttgttcga agttcgtggt
   10351  acaaactggg aacaaaacat gttttgtgcc ggacccttac aagctattgg
   10401  ttaaactggg ggctcctcag tacaaattaa ccgacgatga acttttcgaa
   10451  ctgttcactt cttttaaaga taacactcag gactttggtg atcaggtggt
   10501  cttagagaaa ttgaagttgt tagtagagat taagtacggt tttaccagcg
   10551  gaactactat gcccgctctg tgtgctatac attgcgtacg gtccaattat
   10601  ttatcgttcg agaggttgtt tccctttatc aggggttggt atgttgtcga
   10651  tgctttgaag cttagacaac taaggaagtt cgccaatttg atctgtgaac
   10701  gcgtggttta cgataatcgc gtgggttatt tttcgtactt tgacaatacg
   10751  tttactaaac ccgatgctag cgatggtcaa atggacgact tgatgaccgg
   10801  ttgatcgttt gttcaattct cgctgagagc caacgttggt agttgagtcg
   10851  agatgtttgc tttcgcgagc gaaaatcaag acttattaga agaaaagata
   10901  tttcgtcgta gaacgtacca tcgtaagtat ttcgatgatg tggttaggga
   10951  ttttactatc gatgttggtt acgatattgt tgatcgtgac cctacggtat
   11001  tggctgacta tttctcgtta tatttctttc tgcttaacaa cgataacgtt
   11051  gggcctttag cggcttcaat tgtggtgagc ccgccggtta acgggactta
   11101  taaaattcga gcgcacgtcg ataatcaacc aaattgcgaa ggaaacgtga
   11151  cttacattaa aactatcgat aagagtcgtt ttgcgattct cataaaggca
   11201  gtcccggctc ctatgagagg ttattactct tttcgggcgt tccttgccgc
   11251  tgatgtcact agcgaacgca gtgaattcat atgcagtttt gtcggtagta
   11301  gattcctttg ttgttgtacg caaacgatat ccgaaaattt gagtaaggtt
   11351  tgttcgtctt ctttctcttt tagagctgtc tcaaaaaccg caattaacga
   11401  gttttctgtt gcgattgatg atgtggaaga cgttaagtat gtgagaaagc
   11451  gagctgaggg tttctcacat tgcgccgacc catacccccc taggtgttat
   11501  cgcggcacta atttaggcga ttcttcaggg gttcaaagtc gtacaatcga
   11551  ggaagaaggt tataggacag ataccgcagg taacgtcgcg gtctctatcc
   11601  cgaacacccc actcgttaat gctgtctctc cgtatgtcgc agagtacaac
   11651  gaaaatacgc gttcgcgtat ctcgttgata cgccgagtct gttgttacgc
   11701  tgtttgtgtt ttagtggtgt ctcttcttat aatgagcggt ttgttagcca
   11751  ttatattcat atgatttgat gaagtaaatt acgaggtgca attagctaaa
   11801  actcaccgtt tgactctgtt taaacgggtt tcaatggact gtgtgattca
   11851  aggatttttg acttttctgg ttggtatagc tgtgttttcg gcctttgccg
   11901  gactgattat cattgttata acgatttatc ggtgcacgac taagcctgtt
   11951  aggaacactt ctccttacgg cactcacgcc actgtctaag cggtatggta
   12001  cttctgggtt tagactttgg taccacgttt tcgacggtgg ctatggctac
   12051  atcctctgag ttagttatac tcaaacaatc taattcatcg tacataccta
   12101  catgtttgtt tttgcatgca gaccctaaca gcgtgtctta tggttacgat
   12151  gcggaatatt tagcggcttc tggggagcct ggttcttttt acaaagattt
   12201  gaaacggtgg gttggttgca ctgcgaagaa ctaccaaacc tacttacaca
   12251  aactatcgcc ttcctataag gtgacggtgg aagagtttgg aactaagagt
   12301  gtgccagtcc catatttgtc acctctgaat aacaatttgg gactcagtgt
   12351  cgctttacct ttactaatcg cttcgtatgc caaatccatt ttgtcggatg
   12401  cggaacgagt gttcaatgta agctgcactg gagttatatg ttcggtaccc
   12451  gctggttata acacgttgca acgagctttt acgcagcaga gtatatcgat
   12501  gtcgggttac tcttgcgtgt acattattaa cgaaccttca gcagccgcgt
   12551  actccacttt acctaagttg agttcggcag ataaatattt agccgtttac
   12601  gacttcggcg gtgggacttt cgacgtctct atagttagcg tcagattgcc
   12651  tacgttcgcc gttaggagtt cgggtggtga catgaattta ggtggtagag
   12701  atatcgacaa aaagttatct gataaaatat acgaaatggc agattttata
   12751  ccgcaaaagg aattgaacgt ttctagttta aaggaagctt tatctcttca
   12801  aactgatccg gtcaaatata ctgtaactca tcacggaatg agtgagacga
   12851  tatcaattga tcaaacggcg ttgagggaga tagcttcggt gttcataaat
   12901  cgaacgatag atatacttac gcaagttaaa gttaagtcta gtatgcccga
   12951  atcgcaaagt ttaaagttag tggtggtcgg tggaagctcg tacctaccag
   13001  gattgttgga tactttggca accgtgcctt tcgtgtctgg gatagtacta
   13051  gtggaagacg caagaaccgc ggtcgctaga gggtgtgctt tatatagtga
   13101  gtgcttagat ggtaggtcca aggccctact aatagattgt attacacatc
   13151  atttgtcggt tacgacgttt agcgcggact cggtcgttgt cgcagcggcc
   13201  ggtagtccaa ttccttttga aggagaacaa aaactcacgt tacgcaaatg
   13251  cgttagcacg tctaactatc aagcaagaat gtttgaagga gattacgaaa
   13301  aggttttccg aaatgaacgt atctacgcag cttcagtatc gttgtttact
   13351  ttaggagtta attggcgtgt gcctaccgac gttgaaatga ctctcgtgac
   13401  caaagtggac tcaatgggta aagtggaatt ttaccttaaa ggtccatctg
   13451  gtgaactagt caacgtgcaa ggtacttcgc attacgatta tactggtatg
   13501  cctcacccca ctagaaattt ggtgaagctt agcgattaca atgtaaactc
   13551  cgccgcttta gttttagctt tgacattaac tcgcgaaaaa cgagaaaagt
   13601  ttctttcgcg gactttattt gacactttac tagcagattt gcgaaggaca
   13651  gcaagtttga gcgagtactc aaagaagtac ccgatcactc gaaacgatat
   13701  cgatgtcgtc tcatcacgta tggggatcgt tgtttcgaaa gttttacggg
   13751  gaagcgattt ggaaagaata cctctctgaa tcaactcgaa gttttgatga
   13801  aagaaacgtg tcgttggacc acactttgag ttcgggtgtg gtcgtccgta
   13851  ggcagagtct tttgaatgcg cctcaaggga ctttcgagaa cgagttagcg
   13901  ctattgtata attcggtggt gattaacgat tttgttgagt tgactggtat
   13951  gccattgaag tctttgatga caggtatcga ggaccgtaag gtgcctgacg
   14001  aattaatatc cgttgacccg cacgaagtcg gatgtagatt cacgttaaac
   14051  gacgtggaat catatctaat aagcaggggc gaggattccg ctgatgtaac
   14101  ggcggtcgag cattcgtggt gtttgagtaa ctcttgtggt agactattaa
   14151  gttcgaccga gatagatgct tacaaaacct tggtgtttac caagaatttc
   14201  gatagtaatg tatctggagt gactactaag ttagagactt atctatcgta
   14251  ctgtatatct ttgtacaaga aacactgcat gaaagacgat gattatttta
   14301  atcttatcac acctatgttt aattgtttgg tgaaagtgct ggcgtcactt
   14351  ggtttgtttt atgagaaaca tactgacaat ccgctactga ccggaatgct
   14401  tatagagttt tgcctaaaaa ataaggtgta ttactctact tttaaagtaa
   14451  atttagacaa cgttagattg tttaagtcta aagtgttgcc tgtggtgtta
   14501  acagtttggg atatatctga gcctgatgac ccagtggatg aaagggtgct
   14551  aattcctttc gatcctactg atttcgtgct cgatttacct aaattgaata
   14601  tacacgacac aatggtggtg gtgggtaatc aaatcagaca gttagagtac
   14651  gtagtcgaga gcgatgcttt agacgattta tctcaacacg ttgacatacg
   14701  tttagcagcg gacaaccccg atctacgcgt tgatctgcgt tgggcaggga
   14751  tgtttgtcta ctacggtgtt tatcggtgtg ctattgatag agtggtagaa
   14801  cgaccggcgt tatttagatt gccgcagaag ttattgagtc aggatgatgg
   14851  cgaatcgtgc tcattgcgca tgagtgccgt cgaagcttta tttaatctag
   14901  tgcaaaaggt gaacagggac ataaacgtta gacgtcagtt catgggacgt
   14951  cacagtaaag tggctttgcg actgtatcgc aacttaggtt tgaggtttcc
   15001  accgatctct tcagttaggt taccggttca tcacggttac ttatacgtcg
   15051  atttttacaa aagagtacct gacgatgctg ttactgccga cgaactcgaa
   15101  agtttacgtc aattacgttc gtccgtggac gttatgtgta aggacagggt
   15151  gtcaatcaca cctccaccat tcaatcgact tagaagaggt tcttccagaa
   15201  catttagagg tcgaggcgca cgcggtgcga gctcgcgtca tatgagcaga
   15251  gacgtggcaa cttccggttt taatttacct tatcatggca ggttatacaa
   15301  cacttcctaa taccgatgac aaagaaatgg atccggtgag tgccgctgta
   15351  cccggtaagt atccggatgt cattgaaaaa tttgtggcca acaggtccgt
   15401  agacgcgtta atagaaggcg tcataagtaa gttggatacc aattcaatat
   15451  acgaagattc cactgaaaaa tttactggtg aacacttgaa atatgttatg
   15501  gttactatgg atgctttctt attagaaaac tacaagacga aaacggaaga
   15551  tctgttggtt cacttagcta tgatccaaaa gaggttgtac actacatcca
   15601  cgagcactaa aaccaagttc cgcgataaag gttgtattag ttacgtgcaa
   15651  gggggttcgc gatataagtt aatggataaa gtagtttttc ctttcattat
   15701  atcgaaattt accgacaggg agactccgaa cgctctacgt aagtatgctt
   15751  gcactttcga ggagttacac ttgtgtatgg ctaggttgag acccgactta
   15801  tacgaaaata aaaggacgac taaagccggg actccacatt taaagggcta
   15851  tttatcagcc gactttcttt cgggttctct cccagggtac tccgaacatg
   15901  aacgaggcat cattcttcga gcgtctgagt ctatgttagc tagacgtcaa
   15951  ggttacgagg aggcaaccga gcttcttaac ctacgtgatt tgggtaagta
   16001  cttgtagttg gtttggggac ggtaatatta ttattatacc atcccttgag
   16051  cgctgcttta agggtcgtta attgacgact cttgatatat ttactaggtt
   16101  tgaattatgg acgacgaaac aaagaaattg aagaacaaaa acaaggaaac
   16151  gaaagaaggc gacgaagttg ttgctgctga gtcttctttc ggttccgtaa
   16201  acttacacat cgatccgact ctgataacga tgaacgatgt gcgtcagttg
   16251  agtactcaac agaatgctgc tttgaacagg gacttatttc ttgctctgaa
   16301  agggaagtat cctaacttgc ctgacaaaga taaggacttt cacatagcta
   16351  tgatgttata ccgattagcg gttaagagtt catcattgca aagtgatgat
   16401  gacaccacgg gcataacgta cactcgggag ggtgttgaag tagatttgtc
   16451  tgacaaactt tggaccgaca tcgtgtataa ttctaagggt attggtaacc
   16501  gaactaacgc ccttcgagtc tggggtagaa ctaacgatgc tctttactta
   16551  gccttttgta gacagaaccg caatttgagt tatggcggac gtccgctaga
   16601  tgcagggatt ccggctgggt atcattattt gtgtgcagat ttcttgaccg
   16651  gagctggctt gactgattta gaatgtgctg tgtacataca agctaaagaa
   16701  caattgttga aaaagcgagg ggctgatgag gttgtagtta ctaatgtcag
   16751  gcagcttggg aaatttaaca cacgttgatc tattgcgttc cgattcccgg
   16801  tttctatcgg gatggtggag tttcatcgtg aacgtgggtg atataattgt
   16851  ccggttcgcg ttacacgttc ctaatgaaga tatgctgaat agtttttcag
   16901  ctatatcgaa ttgtacgatt atagcggatg gtagtgcttt actaaaggac
   16951  aatactgtgg ttgaccgttt agaaagcatg aatcctttgg cttatttgtt
   17001  aaaattagcg aaaacgacta ctactatttg ttttaccatg tccaataagg
   17051  ttctttttgg tactaccaaa tccgaaccac ttagttgttt agctgtcacg
   17101  tcggatcgag ttttattcaa agttattatg ggcgctaacg ttgatgattc
   17151  tcggtgcggc tgcagtattt ggttttacaa caatggtact tttcaaaacg
   17201  gattgacccg ttgtaataat ctcgtcactt tgtttagcgc gacttagaca
   17251  cgaagtgacc gttcggattt aattgctgcg atgagtattc gacgcgtgtg
   17301  gttaaaggtt atagctgtaa ttacagtgtt gtggtacggt aaggaacctt
   17351  ctattagtga aggttacaat gctcttatga atgacgactt taaatttatc
   17401  gatacgcatt tttctaacgt ttcttatgct aagaaatgtt acgatttggc
   17451  taatttcgat ttagactttt tgcgcatcgt tatcattcct ttgagtggtg
   17501  gcacggcgaa tgaatcgcgt tctgatcgca ctaacgtttc agagattgtc
   17551  gaatcgcatg taagcgaccg agacagaatg cacatcttgt tgcgtaataa
   17601  gcggatccag attccttcgc tcttaccttg cgataactag agtctactca
   17651  gtagtactct actagtataa cgtattaaac actttagtga ggagttttgt
   17701  ttgaatcaaa caatatgcga gcttacttta gtgttaacga ttacataagc
   17751  cttttggcta aggttggttc agttgtggaa cgtttgtgcg atcccagcgt
   17801  aactctcacg gaagtgatgg acgaaattaa tgattttaac tcgtttctcg
   17851  ctttggtgca ctctatgaag tcggacatga acggcgatca tcaggatggt
   17901  caccatgaga tgggtgaaca taaatctcgg ttgttgtgca atatagaggc
   17951  gaaactgcga gtgcttctcg acatcataag acgtcggttt actcgcgaaa
   18001  aactgctctg taccagtgct acagatgttg tgggcttctt cgtcgtgagg
   18051  tacatgagtt ctagtcacac tagtttcgaa accgtaatgc gaacggaact
   18101  gaagttggtg gttaaagctg tgctgtcgga attgtcccgc acgcataaac
   18151  tagattttag cgagcgagcc tttacggctt acggtatcct tttgcagaag
   18201  ggcaccgtgg caaccgtttg cggtcagttt gacattaatt tagtttctcc
   18251  gtcttgcgtg taggttaata cgcttctcag aacgtatggt tgtattaact
   18301  aactttaatt cgaacatatt tattgtttaa agtctgtgag ttacgatgga
   18351  tgatactagc ggacaaactt tcgtttctgt gaacctttct gacgaaagca
   18401  acacggcaag cactaaagtt gaaaacgtaa aatcggaagc ggatcgcttg
   18451  gagtttttac gtaaaatgaa tccctttatt gttgacgctc tggtgcggaa
   18501  aaccaattat cagggtgctc gctttcgcgc aagaataata ggagtgtgcg
   18551  tggattgtgg tagaaaacac gacaaggcgc tcaagactga acgtaagtgt
   18601  aaggtcaaca acacgcaatc tcagaacgag gtggcgcata tgttgatgca
   18651  cgatcccgtt aagtatctga acaaaagaaa ggctagagcc ttttctaacg
   18701  cagagatgtt tgcgattgaa ctggtttcgt acaccaagga aaggcaattg
   18751  gcggtcgatt tagccgctga aagggagaag acgagactgg ctcgtagaca
   18801  cccaatacgt tctccggaag aaactccgga atattataaa ttcggtatga
   18851  ctgctaaggc aatgttaccg gacatcaacg ccgtagacgt tggtgataac
   18901  gaggaaactt cgtcggagta cccagtgagt ctgagtgttt ctggcggagt
   18951  tctccgtgaa caccacttca tctgattgaa gtggacggaa taagttcctt
   19001  gcggaacttt aagtcgggtt ggtaaaaacc ctttatgatg gtgatgtatc
   19051  actagacaat aaccggatgg gtaaagtctt taaaatgatc gaggggaaaa
   19101  ttaaccgtat cctctcgttg gtctaagctc ccacagagtg gtagtggtct
   19151  caagtgaggc ttaacgtatg cgtgaaccaa agaagttctc cttagagtgt
   19201  gtgttgttta cccaacacac tgtccctatg gggggccaac ataggtcca