Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS703-T30, complete genome.

ACC No: KC517491

Dated: 2013-04-30 | Length: 19253 | CRC: 979343659

                
ID   KC517491; SV 1; linear; genomic RNA; STD; VRL; 19253 BP.
XX
AC   KC517491;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FS703-T30, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19253
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19253
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19253
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="FS703-T30"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: T30"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .108
FT   CDS             109. .9450
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30131.1"
FT                   /translation="MSKLGASFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTDTTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVFDTSGVVRPR
FT                   SVAGAWRYALCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVAK
FT                   LVDPTVRESPQDKTKLKGRRYGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGTLPTTAWCSEADAAVLRCRLDYHAAATSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRIFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKTLGARVRCLWESSDLDDAKV
FT                   RDGQCYIRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSVPNHHLVGGESAHLFVGQIRLDVRGGVSKPSRSVRRRNRR
FT                   LREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSVVGPTLGRIPSVNRKFRFPAGTQLS
FT                   VSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVGG
FT                   LHVFVKRGSFTARFPMSASRYEHHYDASMKGAGLSWVRKSQFPNVEVIRRRRSRASGSS
FT                   ASFPDANLQVSSDRPSESVQVVPMLDEGSSPPRGVPSPRRNPVEGSGWYSVGSPSRRSS
FT                   TTRGQRSAERGKIGDFSFPSGTVYNARVDERAYKRVLKLRDTSASSFLRIVLARLSSYR
FT                   PLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGRL
FT                   LQLDSYGFSEDLRDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYGK
FT                   RAVEYSVRGYFSAPRLYHCCFTDSPRPFRFLNKYHKMGGEEGALLITDTDRLRAVGSVY
FT                   DKVKKALPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEFN
FT                   INFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGIHVCRPVYD
FT                   VKDAHRRVVRHHQLGKVAFDHTDGSKQVGAVNTNTVCGNILGECFHASEAIVMVQVYDV
FT                   PLRELCRAMVNKKTSVCYMTMVTPGELLDARESFFIKELDCSVELDVVADRVVYCFNNS
FT                   AYTHAYSTIREYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEVKRLRYR
FT                   RCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTWN
FT                   YIKSCKSRVVISGKVIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGDT
FT                   SLFELVRFAVSEKCRDLFVGIQEAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELDV
FT                   PIDLPGFGCITEEDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLGS
FT                   DGSDSSLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCVARRLLDLLCERLVGS
FT                   LSRLKFGTTHLTSFFSMLRAKLSCNFFDDSIFTAVWDTVMNLIRIVNGVTKTKLECFRN
FT                   VLRLIPKLCSGCKDFAKDFADMCKSVLLFSTEFFSKSYTKLCRFSLEIFDVGLIEISAR
FT                   NMGLETCVSMASAIFDVILTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTLGKPEIL
FT                   GEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGIIPGVLRIVFSSLFSDADAWVGYSKH
FT                   EVSSLPMITYSAKRLSFVLEQTKEACIAFIVDSSKRILASLTSEIHESLQNSELTSGAK
FT                   SLYGRVSSILSASNGMVNKAGNAVAAVKAAGSGLSKRVKRIRPSFHLARCVNEQTSEYY
FT                   SASDDSELDESLLSDTPGLRGNGKCNDLFRVVSGRVLVYRRRAVEALKRLVLHVGECLY
FT                   SRIADSFVRLFVRTNTAVGKCESLAVDCATKITDLVVGYITWRNLHFGAYSTTPGLSGG
FT                   SRVSLSRLLGDGLTCVIQNFVTAWLTIFNETFYSSLAHRMRTASINVLLEFLKNLPVCL
FT                   VSIYTFIECRSRIFPLKEFLWGFCIFVWNIIKELSVCIYENLPVCVTRLCNRAFRRSSN
FT                   DDDERTLQVITEAENRIGFLREVLAEMARYRASLEIPVPGSPNSPLFPPTYGEIEELGD
FT                   GSSDSARVIGVDNGSDSMSTEGEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFRL
FT                   GLRFVWRMSRNIFNLRVVKFSYGLALQCIFNGRSTGQFISRLLFSFGGCLPFEFFRHVC
FT                   AVRWLSRSLALHVRNASICDEETVEWLFNFSRFLYDSRYLSLVFSELERVEFYLSYLFS
FT                   LPKRCFTHNRSVQVCVRAPVRVVRDVGLVEGGRKSLSEVLNSLDSLKVSNRKGKSAVIE
FT                   SDSSDSESGSSSGSISFGSINEEVLKTANGSVVSEKASLMKHAALSGLEPDLGGKKDLP
FT                   IIRRNFTRGESSGTKSVGSLCEYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFYYS
FT                   QKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVGVVDFNLKVIVGRHGTRPFRNT
FT                   VNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSLIV
FT                   YEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHVIK
FT                   TAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQIHY
FT                   IHRNDLGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSVGKS
FT                   SVSIEVINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPVVNTVHEVQGE
FT                   TYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEAREIF
FT                   DKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGDTS
FT                   EELSSRPFESGCDNVTIRDTAPPDSGNLHEPARVRRSKVAGNSAKKSVPTRKSSVVRKS
FT                   "
FT   CDS             <9323. .10807
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30132.1"
FT                   /translation="GTLLPQTLVIYTNRLVFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPECFGRAMAAAVIERCFKMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   AVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSQHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDDLFIGEVDFSKFDKSQDLFI
FT                   KEYERALYSEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDNTQDFGDQVVLEKLK
FT                   LLVEIKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNTFTKPDASDGHMDDLMTG"
FT   CDS             10856. .11767
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30133.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVNGTYKIRAHVDNQPNCEGNVTYIKT
FT                   IDKSRFAILIKAVPAPMRGYYSFRAFLVADVTSERSEFICSFVGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVSVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11837. .11992
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30134.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             11998. .13782
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30135.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTAKNYQTYLHKLSPSYKVTVEEFGTKSVP
FT                   VPYLSPLNNNLGLNVALPLLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSISMSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDKKLSDKIYEMADFIPQKELNVSSLKEALSLQTDPVKYTVTHHG
FT                   MSETISIDQTALREIASVFINRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LATVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGEQKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPADVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYTGMPHPTRNLVKLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDTLLADLRRTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13706. .15313
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30136.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLNSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTLVFT
FT                   KNFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLITPMFNCLVKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLKNKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPALFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLYNTS"
FT   CDS             15288. .16010
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30137.1"
FT                   /translation="MAGYTTLPNTDDKEMDPVSAAVPGKYPDVIEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEHLKYVMVTMDAFLLENYKTKTEDLLVHLAMIQKRLCTT
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16110. .16781
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30138.1"
FT                   /translation="MDDETKKLKNKNKETKEGDEVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLSTQQNAALNRDLFLALKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDIVYNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16747. .17250
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30139.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAVTSDRVLFKVIMGANVDDSRCGCSIWFYNNGTFQNGLTRCNNLVTL
FT                   FSAT"
FT   CDS             17284. .17643
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30140.1"
FT                   /translation="MSIRRVWLKVIAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTANESRSDRTNVSEIVESHVSDRDRMHILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17719. .18267
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30141.1"
FT                   /translation="MRAYFSVNDYISLLAKVGSVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VVGFFVVRYMSSSHTSFETVMRTELKLVVKAVLSELSRTHKLDFSERAFTAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18350. .18979
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30142.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTKVENVKSEADRLEFLRKMNPFI
FT                   VDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVSYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEY
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18980. .19253
XX
SQ   Sequence 19253 BP; 4721 A; 3828 C; 4903 G; 5801 T; 0 other;

kc517491 Length: 19253  30-APR-2013  Type: N  Check: 1847  ..

       1  aatttcgatt caaattcacc cgtacctccg gagctcgatc cggaccctgc
      51  gggacttggt gtaaatccca accagacggt tgctctacgc ccataatatc
     101  aatacaacat gtcgaaactc ggagctagct tcaagtcctc gactttcgct
     151  gtacgcagcg attacataat ttcgcgcatc tggcgcgcct ttaataccgt
     201  tggagtcctg cacttcttcg gcactgatac aaccactacg gtggttaagg
     251  agttttcggc tgctgggccg atcgtccctt tacggaaatc ctgttttccg
     301  ttctcagttc gcgctgctgt tcgcgcgatt aaagctgccg gacgtcctat
     351  tgacgctccg cgctccggat gcctctgtgg cctccctgtt ttcgacacat
     401  ctggtgtcgt gcgtccccgc tctgttgcgg gcgcttggag gtatgctctg
     451  tgtaaacctc cccttactgc tgccgccaag aagtccattc gcaaggcgaa
     501  gaaagattct gcattctttc tcagccgggc ttcttctctc ttctctcggg
     551  aagtcccttg cggcacgcgt cacagacttc gcaggcgtgt tgcgaaacta
     601  gttgacccta ctgtgcgtga aagtccccaa gacaagacta aacttaaggg
     651  gcgccgatat ggcaaaaatt ctgacctccc gtatatgggg gaagcggcgt
     701  tggatgacat ccttcgctgg attgaggggg taaatcctcc gccgtcgatg
     751  gtcgccattc cggtgcccat ctcttttggc actctgccca ctacggcttg
     801  gtgctctgag gccgacgccg ctgttctgcg gtgtcgctta gactatcacg
     851  ccgctgcgac ttcctttcgt aatgaaggga agcacgtgag atacgtctat
     901  aatgacgtgt cttccgctgc caaccgtcct cgtacggttt ctccccgcaa
     951  gtgcgggcgt atttttccca gcggttctgc gctgggtgtt gaggttccaa
    1001  gtactaggga ccgccacacc gctttcgtga gatctactca cgctagcgtt
    1051  ttcttttctg acgcggttcg ccgcgttcga atgttccgtc ctgggcggaa
    1101  taatttcttt actagcgtcg tcagtgggcg gcgcgttagt tactttagac
    1151  ccggacctaa cggtacggtg tctgttctaa tgtcggatgg cgtcaatacg
    1201  gcgcgtctcg acgttgtcgc tcccgcgtac tatgcgtacg caaaaacgtt
    1251  gggcgccaga gtgcgctgtt tgtgggagtc gtccgatttg gacgatgcta
    1301  aagtacgtga cggtcaatgc tacattcgtc acgtgtacga cgtggcccta
    1351  tattttggga ggcgcgtcga cctttctgtg cgccgcactt tgggtttatt
    1401  ccccacagtg ggtgcgttaa aggcttatct tgttcgcgag tacggtcgcg
    1451  actctttgaa ggttccgatg cgcgggactt acacttttgg cagtgtattt
    1501  cattgcctgt cgactaaatc ttctgtcgac ttaagatctg ttcctaacca
    1551  tcacttggtt ggtggtgagt ctgctcactt gtttgttggg cagattcgtc
    1601  ttgatgtccg tggtggcgtc tctaagccat cacggtcggt tcgcaggcgt
    1651  aatagacgtt tgcgtgagga cggttttcta ggtagtaccg attcatcttc
    1701  ttcaggaggg tcgagatact gttcagattg ttcgactcct cgcagtccac
    1751  cctctccgtc ggttgttggg ccaactcttg gtcggatacc gagtgtaaac
    1801  cggaaattcc ggtttccagc aggcactcag ttgagcgttt ctatccctaa
    1851  acgcgatgac gatcgcgtgt acgtgtcggt tggtcaagac tttgatgagt
    1901  tgtgccatgc cgtgtgtacc tacgttaaga ggtacaattc gagaaaagcg
    1951  ttttacacgc gttttgaaaa cggtgacgat tttgctgtca ttcggcgtgc
    2001  ttccgtcgga ggtcttcacg tgttcgtgaa acgcggtagt tttacggctc
    2051  gtttcccaat gtcggcttca aggtatgagc atcattatga tgcaagtatg
    2101  aaaggcgccg gtttgtcctg ggtgcggaag agtcaatttc cgaacgttga
    2151  agttatacgc cgtcgaagga gccgggcaag cggttcttcg gctagttttc
    2201  cggacgcgaa tttacaggtt agttcagacc gaccgtcgga gtctgtccaa
    2251  gtggttccga tgttggatga gggttcttca ccacctcgag gagtgccctc
    2301  gccccgacgc aatcctgtcg aagggtcggg ctggtatagc gtgggttctc
    2351  ctagtcggcg ctcgagtact actcgtgggc aacgttccgc tgaacgtggg
    2401  aagattgggg atttcagttt tccgagtggc actgtgtaca acgcacgcgt
    2451  ggacgagcgt gcttataaac gtgtcttaaa gttgcgggac acgtcggcat
    2501  cctcctttct tcgtatagtt cttgctcgtt tgtcgagtta tcgacctctt
    2551  agtgacgaat tctttaacaa atgcgttact tctcgatttg tagcttgtat
    2601  cgaggcggtt gaatcaggtc tcgttacagt acactttcga tcagacgtgt
    2651  ttcgtgcttc tttccctttt ggtgtttatt tatacactcg tcacgcgttt
    2701  gatatttaca gtggtaggct cctgcaatta gacagctacg ggttttcaga
    2751  agacctaaga gacggctact gttatattcg tcacattgct gaagtgtgtt
    2801  tgagtatggg gaaggttttc tttaggaggg acgttaactt aggggcgttc
    2851  ccttatgttt tcgaggtaca gcaccgtctt gagcggttgt atggtaagcg
    2901  ggctgttgag tacagcgtta gaggttattt ttcagcaccg cgtctttacc
    2951  attgttgctt taccgattcg cctagaccct tcagattttt aaataagtat
    3001  cataagatgg gtggcgaaga aggtgcgttg ttgattactg acactgacag
    3051  attgcgtgcc gtagggagtg tttatgataa ggttaagaaa gctttgcccg
    3101  attctttact cgttcgatca gtagagaaag atttgataga attcaatcaa
    3151  actctggtcg atacgcaacg ggctagaccc ggtgttgcag tgccttttca
    3201  gatgagtgag aaccaacagg tgatgctcac tagagcctat cctgagttta
    3251  atataaactt tactcattcc gtacactccg atcatcccgt ggctgcgggc
    3301  tccagaatgt tagagaatca cctcgttcgc aaatatgcag gcagtgacta
    3351  ttcggacgta ggtggttgcc cactatttca tttgcgtgca ggccacacag
    3401  gaattcacgt ttgcagaccg gtgtacgatg ttaaagacgc ccaccgtaga
    3451  gtcgttcgtc atcatcaact tggtaaagta gctttcgatc atactgacgg
    3501  gtctaagcag gttggtgctg tcaatacgaa tactgtgtgc ggcaacattt
    3551  taggggagtg ttttcatgcg tctgaagcga ttgttatggt gcaggtttac
    3601  gatgtgccac tgcgagagtt gtgtagagct atggtaaaca agaaaacttc
    3651  ggtgtgttat atgaccatgg tcacacctgg cgagttgttg gacgctcgtg
    3701  agtccttctt catcaaagag ttggactgtt cggtagagtt ggacgttgtc
    3751  gccgataggg ttgtttactg ctttaacaat tcggcgtaca cgcacgcgta
    3801  ttctacgata cgcgaataca tgcgtactcc ttgtgtggtg gtggatggtt
    3851  ttctattcac tatagagatg gtttcgctta gatgcagcgt taattattat
    3901  tgcatcacca aatcgcgggt ctgtccgaga attagtgagg ttaaacgact
    3951  acgctatcgt cggtgtgata gcgacttgat taggattaag attcctcggt
    4001  actccagcaa gactcgtagt tgtttaccgg ggtgttatta tttgtacttg
    4051  gacgctaagt tcgttagtcg cgtgtacgaa tacgtagtta ataattgtgt
    4101  tgtggtgaat gctaagactt ttgaatggac ttggaactac atcaagtcct
    4151  gtaagtcgag agtggtcatt agtgggaagg tcatccatag agatgttcct
    4201  atagcgttgg agtatttgga tgggttttcc gcggttatgt tgtccgcggg
    4251  cgtgaaaggt aggcagaacg cagaagcgtt ttctaggcgt ctggctgcct
    4301  tttcaggaga tacttctctt ttcgaattgg tgaggtttgc cgtttcagag
    4351  aagtgtcgcg atttatttgt gggcattcag gaggctgtgg agaggtgcgt
    4401  gaaatcatac cttaggaact cgtttaatat gagtttcgta gacttgtcag
    4451  atcctttgct tactattagt gagtactcgg agttagatgt tcctatcgat
    4501  ttgccgggtt tcggctgcat aacagaagag gatgaggcta aactcataga
    4551  agatggggtt aagtcggctt tgctacgaaa agcggttcgt gacgaggcgc
    4601  aacttattct cgaaaggggt ggtacgtcgg agatcgttcc ttgtggggat
    4651  gatgatggtt tgggcagcga tggttctgac agttcactcg ggtcaggtag
    4701  tgattcgtcc tctaaagcta gttctggtgg tttacgtgcc ggagccgccc
    4751  cttcactgtt tagaagctta ctgaagaagt tgggcggggg tttttgtgtg
    4801  gccagaaggt tattggactt gttgtgcgag cgattagttg gttcgttgtc
    4851  gcgcctaaag ttcggcacca ctcatttaac ctcattcttt agcatgttac
    4901  gcgctaagct ttcgtgtaat ttcttcgacg actcgatttt taccgccgtt
    4951  tgggacacgg taatgaactt aattagaatc gttaacgggg tgaccaagac
    5001  gaagttggag tgttttcgca acgtacttcg gttaatacct aagttgtgtt
    5051  ctggttgtaa agactttgcg aaggactttg cggacatgtg caagtcagtt
    5101  ttgctatttt ctacggaatt cttcagtaaa agctatacta aactgtgtcg
    5151  gtttagtttg gaaatattcg atgttggact tattgaaatt tcagcccgta
    5201  atatgggact ggagacttgt gtttcgatgg cttcagctat ttttgatgtc
    5251  atacttacct atcctctggg aagtattagc tttcccgtcg tttgtgcgag
    5301  agtttttggc gccctcgcta tggaagtggg atcgaactat tgctttaaga
    5351  aaactctcgg caaacccgaa attttaggag aggatgcttt tcgtagaacg
    5401  gtaagtatgg tgttgagcgc taaggctttc gacaaacttt cagtcgatgc
    5451  taagggttta gttagatgtt ccggtattat tcctggagta ttgaggatag
    5501  tgttttcatc tctgttttcc gatgctgacg catgggtggg ttatagcaag
    5551  cacgaagttt cctcacttcc catgatcacg tatagtgcga aaaggttatc
    5601  tttcgtgttg gagcagacta aggaagcgtg catcgctttc atagtcgatt
    5651  cgtctaagag aatcttagcg tctttgacct cggagattca cgagtctttg
    5701  caaaactcgg aacttactag tggtgctaaa tccttgtatg gacgtgtgag
    5751  ttctatactc tcagcatcca atggaatggt taacaaggca ggaaacgccg
    5801  tcgcagcagt taaggcggcg gggagtggtc ttagtaaacg tgtgaagcgc
    5851  attcgtcctt cctttcacct tgctcggtgt gttaacgaac agaccagcga
    5901  atactattct gccagtgacg actctgagtt ggacgagtcg ctgcttagtg
    5951  acacacccgg tcttcgtggt aacgggaagt gtaacgattt atttcgtgtc
    6001  gtttccgggc gtgtcttagt atatcgcagg cgcgctgtag aagccttgaa
    6051  gcgtttagtc ctacacgtcg gtgaatgctt gtactcgcgc attgcggact
    6101  ctttcgtgag gttgttcgta agaaccaaca ctgcagtcgg gaagtgtgaa
    6151  tccttggctg tcgactgtgc cacaaaaatt actgatttag tagtcggata
    6201  tatcacttgg cgtaatcttc attttggtgc gtattcgaca actccagggt
    6251  tatctggcgg tagtagagtt tctctttcca ggctcttggg tgatggtctc
    6301  acgtgtgtaa ttcaaaattt cgttaccgcg tggttgacga ttttcaatga
    6351  gaccttttat tcgagtttgg cccatcggat gaggactgcc tcgataaatg
    6401  tgttgttaga gttcctgaag aacctcccag tttgtttagt ttcgatatac
    6451  actttcatag agtgtagatc taggattttt cctttgaagg agtttctttg
    6501  gggcttttgc attttcgtct ggaacatcat caaagaactt tccgtatgta
    6551  tttacgaaaa tcttcccgtt tgcgttacga ggttgtgtaa tagggcattc
    6601  cgtcgtagtt ccaatgatga tgatgagcgc acgcttcaag taatcactga
    6651  agctgaaaac cgaattgggt ttttgcgaga ggttctcgcc gaaatggcac
    6701  ggtatcgtgc gtctctcgag attcccgtgc cggggtcgcc taacagtcct
    6751  ttgtttccac cgacatacgg tgagatcgag gaactaggtg acggttcttc
    6801  tgatagtgcc cgagtgatag gtgtggacaa cggttcagac tcaatgtcca
    6851  ctgaagggga agcggaacta gattcggatg gtgatagcga tgattcaata
    6901  cctttggatc gtgactttga gcagatcgga ggtcttggag gaagcggcaa
    6951  cgtcgacgtc tttcgtctag ggttgaggtt cgtgtggaga atgtcgcgta
    7001  atatatttaa cttaagagtc gttaaatttt cttatggttt agctcttcag
    7051  tgtatattta acggcagatc gacgggccag tttatatcgc gactgttatt
    7101  cagtttcggc ggctgtttac cgtttgagtt cttcaggcac gtttgtgctg
    7151  tgaggtggtt gtcaaggagc ttggcattac acgttcgtaa cgctagtatc
    7201  tgcgacgaag aaacggttga atggcttttc aatttttcgc gatttttgta
    7251  cgattcgcgt tatttatccc tcgtgttttc ggagttggag agggtcgaat
    7301  tttacttaag ttacctgttc tcgttgccga agaggtgttt cacgcataac
    7351  cgcagcgttc aagtttgcgt tagagctcca gttcgtgtgg ttagggacgt
    7401  gggacttgta gaaggtggta ggaagtcttt atccgaagtg ttgaactctt
    7451  tggactcctt gaaggtgtct aaccgtaaag ggaagtcagc ggttattgaa
    7501  agtgatagtt ccgattctga gagcggtagc tcgtccggtt ccatctcgtt
    7551  cggatcgatt aatgaggaag ttttaaaaac ggcgaacggt agcgttgtat
    7601  ctgaaaaagc ttcgttgatg aagcatgcgg ccctaagcgg gttggaacca
    7651  gatcttggtg gtaagaaaga tcttcctatt attaggagaa atttcacccg
    7701  cggtgagtct tcaggtacaa aatcggtagg gagcttgtgc gagtacttga
    7751  cgaccttaaa ttcctcgttc ggttcggtgc cggacttgta tcccgtcgca
    7801  cgtgacataa cgtacaagaa gatgaccaac gccatgcgtg aattctatta
    7851  ttcgcaaaaa gtaacgttgt atgaacttca tggaaaatta agctcgtact
    7901  gggacgagtt aaagacggtg ggtttcgaca ggaaattggc gaagatggat
    7951  ttggacgatg acgttggtgt tgtcgatttt aacttgaagg tgatagtggg
    8001  aaggcatggt actcgtcctt tcagaaatac tgtgaattct cacgagttca
    8051  tgttttgcga cgacggtttg gtgctttgcc cgggtccgaa aaaacgcgat
    8101  ttcgctttga tctctagtca aacgcaattc gttgctgcga actcatttct
    8151  acgtgccgtg gacggcaaag atttgacgtt cactaattcg gagcatagtc
    8201  ttatagttta tgaggctcct cccggtggtg ggaagacgca ttccttggta
    8251  acgtatttcg ccgattattg tactaaagtg tcttgcctag tggtgaccgc
    8301  taacaagaat tcgcaagcgg agatttctca aaggatctct agagagttaa
    8351  tggatagaaa aatgcttgct aaacatgtta ttaaaaccgc cggtagagtg
    8401  ttcaccgtgg actcttattt gatgaaccat attcgactta agactgactt
    8451  gttgtttgtc gatgagtgtt ttatggttca tgctggagca atcggagcag
    8501  ttgttgaatt cacttcatgt aaggccgtgg ttttcttcgg tgatagtaga
    8551  caaattcatt acattcaccg gaacgatctt ggtgtttcgt tgttacatga
    8601  catagacgca tttatagaac cacagcaccg catttacggt gaggtgtctt
    8651  acaggtgtcc ttgggacatc tgtgagtggt tgtctaaatt ctatccgaga
    8701  catgtagcta ctgctaacac tggaagtgtc gggaaatcga gtgtgtctat
    8751  agaggtaata aatggatgtg acgatgttcc ttacgacagt agtgcgaagt
    8801  atatcgttta cacacaagca gaaaagaacg aactgcaaaa gcaccttggt
    8851  cgtttaaccg taggccgaac taaagcggtg cctgttgtga acacagtaca
    8901  tgaagttcaa ggggaaacgt ataagaaggt ccgtttggta aggtgcaaat
    8951  accaagagga cactcctttc tgttcggata atcatgtcgt tgtggcctta
    9001  accaggcatg tcgactcctt aacttactct gttttgaata gtaggagata
    9051  cgacaagact gcttctagta tagatgaagc gagggagatt tttgacaaat
    9101  ttcgttcgac gaaccattct cacggttcct caacgttaga atggtacctc
    9151  gaaaagtatc ctactgaata taagggtagc aaagcatctt cggcaccgtt
    9201  aagttgtatt aacgagtttc ttaacgaggt cgttgtcggt tcttcggttg
    9251  tgcagttggg agacacttct gaagaattga gttctcgccc ttttgagtcc
    9301  gggtgtgaca atgttaccat aagggacact gctcccccag actctggtaa
    9351  tttacacgaa ccggctcgtg ttcggcgtag taaggtcgca ggcaattccg
    9401  ccaagaaaag cgtccctaca agaaaatctt ctgtcgtacg aaagtcgtaa
    9451  ttacaacttt ataaagacag agcggtttgt ggggcctgaa tgttttggca
    9501  gagctatggc tgcggctgtt attgagaggt gttttaagat ggatgaagtg
    9551  gccaagataa gaagcgatat tattgcttta actgaagcca atattcaaaa
    9601  atggctcgat aagcgtactc cgtgtcaggt gaaagccgtg caggctgaac
    9651  tgaagttacc gttcgctgtg gaagagcaaa tcactaacta caaactaatg
    9701  gttaagcgtg acgctaaagt gaagctcgat gattcgagtc tgtcccagca
    9751  tcctgccgcg cagaacatta tgtttcataa gaaatttatc aacgctattt
    9801  attctccatg cttcgatgaa tttaagaata gagtgttatc gtcactaaac
    9851  ggtaatatag ttttctttac tgagatgacg aacgctgggt tggcggaagt
    9901  tatcaggagg attataggcg atgacgacga ccttttcatt ggggaagtgg
    9951  atttcagtaa gttcgacaag tctcaagatt tgttcatcaa ggagtatgag
   10001  cgcgcattat actctgagtt cgggtttgat gacgaacttc ttgacgtgtg
   10051  gatggaaggc gagtaccgcg ctagggctac tacgttagac ggtcagctga
   10101  gtttttcggt cgacggtcaa cgccgttcgg gaggttcgaa cacgtggatt
   10151  gggaactctt tggttacctt aggtatccta tctttgtact acgacgtctc
   10201  aaagttcgag ctactactca tttctggcga cgactctctg atctattcaa
   10251  aagaaaagat tagtaacttt tcttcagaaa tttgtctgga gacaggtttt
   10301  gaaactaagt ttatgtctcc tagcgtaccg tacttttgtt cgaagttcgt
   10351  ggtacaaact gggaacaaaa catgttttgt gccggaccct tacaagctat
   10401  tggttaaact gggggctcct cagtacaaat taaccgacga tgaacttttc
   10451  gaactgttca cttcttttaa agataacact caggactttg gtgatcaggt
   10501  ggtcttagag aaattgaagt tgttagtaga gattaagtac ggttttacca
   10551  gcggaactac tatgcccgct ctgtgtgcta tacattgcgt acggtccaat
   10601  tatttatcgt tcgagaggtt gtttcccttt atcaggggtt ggtatgttgt
   10651  cgatgctttg aagcttagac aactaaggaa gttcgccaat ttgatctgtg
   10701  aacgcgtggt ttacgataat cgcgtgggtt atttttcgta ctttgacaat
   10751  acgtttacta aacccgatgc tagcgatggt cacatggacg acttgatgac
   10801  tggttgatcg tttgttcgat tctcgctgag agccaacgtt ggtagttgag
   10851  tcgagatgtt tgctttcgcg agcgaaaatc aagacttatt agaagaaaag
   10901  atatttcgtc gtagaacgta ccatcgtaag tatttcgatg atgtggttag
   10951  ggattttact atcgatgttg gttacgatat tgttgatcgt gaccctacgg
   11001  tattggctga ctatttctcg ttatatttct ttctgcttaa caacgataac
   11051  gttgggcctt tagcggcttc aattgtggtg agcccgccgg ttaacgggac
   11101  ttataaaatt cgagcgcacg tcgataatca accaaattgc gaaggaaacg
   11151  tgacttacat taaaactatc gataagagtc gttttgcgat tctcataaag
   11201  gcagtcccgg ctcctatgag aggttattac tcttttcggg cgttccttgt
   11251  cgctgatgtc actagcgaac gcagtgaatt catatgcagt tttgtcggta
   11301  gtagattcct ttgttgttgt acgcaaacga tatccgaaaa tttgagtaag
   11351  gtttgttcgt cttctttctc ttttagagct gtctcaaaaa ccgcaattaa
   11401  cgagttttct gttgcgattg atgatgtgga agacgttaag tatgtgagaa
   11451  agcgagctga gggtttctca cattgcgccg acccataccc ccctaggtgt
   11501  tatcgcggca ctaatttagg cgattcttca ggggttcaaa gtcgtacaat
   11551  cgaggaagaa ggttatagga cagataccgc aggtaacgtc gcggtctctg
   11601  tcccgaacac cccactcgtt aatgctgtct ctccgtatgt cgcagagtac
   11651  aacgaaaata cgcgttcgcg tatctcgttg atacgccgag tctgttgtta
   11701  cgctgtttgt gttttagtgg tgtctcttct tataatgagc ggtttgttag
   11751  ccattatatt catatgattt gatgaagtaa attacgaggt gcaattagct
   11801  aaaactcacc gtttgactct gtttaaacgg gtttcaatgg actgtgtgat
   11851  tcaaggattt ttgacttttc tggttggtat agctgtgttt tcggcctttg
   11901  ccggactgat tatcattgtt ataacgattt atcggtgcac gactaagcct
   11951  gttaggaaca cttctcctta cggcactcac gccactgtct aagcggtatg
   12001  gtacttctgg gtttagactt tggtaccacg ttttcgacgg tggctatggc
   12051  tacatcctct gagttagtta tactcaaaca atctaattca tcgtacatac
   12101  ctacatgttt gtttttgcat gcagacccta acagcgtgtc ttatggttac
   12151  gatgcggaat atttagcggc ttctggggag cctggttctt tttacaagga
   12201  tttgaaacgg tgggttggtt gcactgcgaa gaactaccaa acctacttac
   12251  acaaactatc gccttcctat aaggtgacgg tggaagagtt tggaactaag
   12301  agtgtgccag tcccatattt gtcacctctg aataacaatt tgggactcaa
   12351  tgtcgcttta cctttactaa tcgcttcgta tgccaaatcc attttgtcgg
   12401  atgcggaacg agtgttcaat gtaagctgca ctggagttat atgttcggta
   12451  cccgctggtt ataacacgtt gcaacgagct tttacgcagc agagtatatc
   12501  gatgtcgggt tactcttgcg tgtacattat taacgaacct tcagcagccg
   12551  cgtactccac tttacctaag ttgagttcgg cagataaata tttagccgtt
   12601  tacgacttcg gcggtgggac tttcgacgtc tctatagtta gcgtcagatt
   12651  gcctacgttc gccgttagga gttcgggtgg tgacatgaat ttaggtggta
   12701  gagatatcga caaaaagtta tctgataaaa tatacgaaat ggcagatttt
   12751  ataccgcaaa aggaattgaa cgtttctagt ttaaaggaag ctttatctct
   12801  tcaaactgat ccggtcaaat atactgtaac tcatcacgga atgagtgaga
   12851  cgatatcaat tgatcaaacg gcgttgaggg agatagcttc ggtgttcata
   12901  aatcgaacga tagatatact tacgcaagtt aaagttaagt ctagtatgcc
   12951  cgaatcgcaa agtttaaagt tagtggtagt cggtggaagc tcgtacctac
   13001  caggattgtt ggatactttg gcaaccgtgc ctttcgtgtc tgggatagta
   13051  ccagtggaag acgcaagaac cgcggtcgct agagggtgtg ctttatatag
   13101  tgagtgctta gatggtaggt ccaaggccct actaatagat tgtattacac
   13151  atcatttgtc ggttacgacg tttagcgcgg actcggtcgt tgtcgcagcg
   13201  gccggtagtc caattccttt tgaaggagaa caaaaactca cgttacgcaa
   13251  atgcgttagc acgtctaact atcaagcaag aatgtttgaa ggagattacg
   13301  aaaaggtttt ccgaaatgaa cgtatctacg cagcttcagt atcgttgttt
   13351  actttaggag ttaattggcg tgtgcctgcc gacgttgaaa tgactctcgt
   13401  gaccaaagtg gactcaatgg gtaaagtgga attttacctt aaaggtccat
   13451  ctggtgaact agtcaacgtg caaggtactt cgcattacga ttatactggt
   13501  atgcctcacc ccactagaaa tttggtgaag cttagcgatt acaatgtaaa
   13551  ctccgccgct ttagttttag ctttgacatt aactcgcgaa aaacgagaaa
   13601  agtttctttt gcggacatta tttgacactt tactagcaga tttgcgaagg
   13651  acagcaagtt tgagcgagta ctcaaagaag tacccgatca ctcgaaacga
   13701  tatcgatgtc gtctcatcac gtatggggat cgttgtttcg aaagttttac
   13751  ggggaagcga tttggaaaga atacctctct gaatcaactc gaagttttga
   13801  tgaaagaaac gtgtcgttgg accacacttt gagttcgggt gtggtcgtcc
   13851  gtaggcagag tcttttgaat gcgcctcaag ggactttcga gaacgagtta
   13901  gcgctattgt ataattcggt ggtgattaac gattttgttg agttgactgg
   13951  tatgccattg aactctttga tgacaggtat cgaggaccgt aaggtgcctg
   14001  acgaattaat atccgttgac ccgcacgaag tcggatgtag attcacgtta
   14051  aacgacgtgg aatcatatct aataagcagg ggcgaggatt ccgctgatgt
   14101  aacggcggtc gagcattcgt ggtgtttgag taactcttgt ggtagactat
   14151  taagttcgac cgagatagat gcttacaaaa ccttggtgtt taccaagaat
   14201  ttcgatagta atgtatctgg agtgactact aagttagaga cttatctatc
   14251  gtactgtata tctttgtaca agaaacactg catgaaagac gatgattatt
   14301  ttaatcttat cacacctatg tttaattgtt tggtgaaagt gctggcgtca
   14351  cttggtttgt tttatgagaa acatactgac aatccgctac tgaccggaat
   14401  gcttatagag ttttgcctaa aaaataaggt gtattactct acttttaaag
   14451  taaatttaga caacgttaga ttgtttaagt ctaaagtgtt gcctgtggtg
   14501  ttaacagttt gggatatatc tgagcctgat gacccagtgg atgaaagggt
   14551  gctaattcct ttcgatccta ctgatttcgt gctcgattta cctaaattga
   14601  atatacacga cacaatggtg gtggtgggta atcaaatcag acagttagag
   14651  tacgtagtcg agagcgatgc tttagacgat ttatctcaac acgttgacat
   14701  acgtttagca gcggacaacc ccgatctacg cgttgatctg cgttgggcag
   14751  ggatgtttgt ctactacggt gtttatcggt gtgctattga tagagtggta
   14801  gaacgaccgg cgttatttag attgccgcag aagttattga gtcaggatga
   14851  tggcgaatcg tgctcattgc gcatgagtgc cgtcgaagct ttatttaatc
   14901  tagtgcaaaa ggtgaacagg gacataaacg ttagacgtca gttcatggga
   14951  cgtcacagta aagtggcttt gcgactgtat cgcaacttag gtttgaggtt
   15001  tccaccgatc tcttcagtta ggttaccggt tcatcacggt tacttatacg
   15051  tcgattttta caaaagagta cctgacgatg ctgttactgc cgacgaactc
   15101  gaaagtttac gtcaattacg ttcgtccgtg gacgttatgt gtaaggacag
   15151  ggtgtcaatc acacctccac cattcaatcg acttagaaga ggttcttcta
   15201  gaacatttag aggtcgaggc gcacgcggtg cgagctcgcg tcatatgagc
   15251  agagacgtgg caacttccgg ttttaattta ccttatcatg gcaggttata
   15301  caacacttcc taataccgat gacaaagaaa tggatcctgt gagtgccgct
   15351  gtacccggta agtatccgga tgtcattgaa aaatttgtgg ccaacaggtc
   15401  cgtagacgcg ttaatagaag gcgtcataag taagttggat accaattcaa
   15451  tatacgaaga ttccactgaa aaatttactg gtgaacactt gaaatacgtt
   15501  atggttacta tggatgcttt cttattagaa aactacaaga cgaaaacgga
   15551  agatctgttg gttcacttag ctatgatcca aaagaggttg tgcactacat
   15601  ccacgagcac taaaaccaag ttccgcgata aaggttgtat tagttacgtg
   15651  caagggggtt cgcgatataa gttaatggat aaagtagttt ttcctttcat
   15701  tatatcgaaa tttaccgaca gggagactcc gaacgctcta cgtaagtatg
   15751  cttgcacttt cgaggagtta cacttgtgta tggctaggtt gagacccgac
   15801  ttatacgaaa ataaaaggac gactaaagcc gggactccac atttaaaggg
   15851  ctatttatca gccgactttc tttcgggttc tctcccaggg tactccgaac
   15901  atgaacgagg catcattctt cgagcgtctg agtctatgtt agctagacgt
   15951  caaggttacg aggaggcaac cgagcttctt aacctacgtg atttgggtaa
   16001  gtacttgtag ttggtttggg gacggtaata ttattattat accatccctt
   16051  gagcgctgct ttaagggtcg ttaattgacg actcttgata tatttactag
   16101  gtttgaatta tggacgacga aacaaagaaa ttgaagaaca aaaacaagga
   16151  aacgaaagaa ggcgacgaag ttgttgctgc tgagtcttct ttcggttccg
   16201  taaacttaca catcgatccg actctgataa cgatgaacga tgtgcgtcag
   16251  ttgagtactc aacagaatgc tgctttgaac agggacttat ttcttgctct
   16301  gaaagggaag tatcctaact tgcctgacaa agataaggac tttcacatag
   16351  ctatgatgtt ataccgatta gcggttaaga gttcatcatt gcaaagtgat
   16401  gatgacacca cgggcataac gtacactcgg gagggtgttg aagtagattt
   16451  gtctgacaaa ctttggaccg acatcgtgta taattctaag ggtattggta
   16501  accgaactaa cgcccttcga gtctggggta gaactaacga tgctctttac
   16551  ttagcctttt gtagacagaa ccgcaatttg agttatggcg gacgtccgct
   16601  agatgcaggg attccggctg ggtatcatta tttgtgtgca gatttcttga
   16651  ccggagctgg cttgactgat ttagaatgtg ctgtgtacat acaagctaaa
   16701  gaacaattgt tgaaaaagcg aggggctgat gaggttgtag ttactaatgt
   16751  caggcagctt gggaaattta acacacgttg atctattgcg ttccgattcc
   16801  cggtttctat cgggatggtg gagtttcatc gtgaacgtgg gtgatataat
   16851  tgtccggttc gcgttacacg ttcctaatga agatatgctg aatagttttt
   16901  cagctatatc gaattgtacg attatagcgg atggtagtgc tttactaaag
   16951  gacaatactg tggttgaccg tttagaaagc atgaatcctt tggcttattt
   17001  gttaaaatta gcgaaaacga ctactactat ttgttttacc atgtccaata
   17051  aggttctttt tggtactacc aaatccgaac cacttagttg tttagctgtc
   17101  acgtcggatc gagttttatt caaagttatt atgggtgcta acgttgatga
   17151  ttctcggtgc ggctgcagta tttggtttta caacaatggt acgtttcaaa
   17201  acggattgac ccgttgtaat aatctcgtca ctttgtttag cgcgacttag
   17251  acacgaagtg accgttcgga tttaattgct gcgatgagta ttcgacgcgt
   17301  gtggttaaag gttatagctg taattacagt gttgtggtac ggtaaggaac
   17351  cttctattag tgaaggttac aatgctctta tgaatgacga ctttaaattt
   17401  atcgatacgc atttttctaa cgtttcttat gctaagaaat gttacgattt
   17451  ggctaatttc gatttagact ttttgcgcat cgttatcatt cctttgagtg
   17501  gtggcacggc gaatgaatcg cgttctgatc gcactaacgt ttcagagatt
   17551  gtcgaatcgc atgtaagcga ccgagacaga atgcacatct tgttgcgtaa
   17601  taagcggatc cagattcctt cgctcttacc ttgcgataac tagagtctac
   17651  tcagtagtac gtctactagt ataacgtatt aaacacttta gtgaggagtt
   17701  ttgtttgaat caaacaatat gcgagcttac tttagtgtta acgattacat
   17751  aagccttttg gctaaggttg gttcagttgt ggaacgtttg tgcgatccca
   17801  gcgtaactct cacggaagtg atggacgaaa ttaatgattt taactcgttt
   17851  ctcgctttgg tgcactctat gaagtcggac atgaacggcg atcatcagga
   17901  tggtcaccat gagatgggtg aacataaatc tcggttgttg tgcaatatag
   17951  aggcgaaact gcgagtgctt ctcgacatca taagacgtcg gtttactcgc
   18001  gaaaaactgc tctgtaccag tgctacagat gttgtgggct tcttcgtcgt
   18051  gaggtacatg agttctagtc acactagttt cgaaaccgta atgcgaacgg
   18101  aactgaagtt ggtggttaaa gctgtgctgt cggaattgtc ccgcacgcat
   18151  aaactagatt ttagcgagcg agcctttaca gcttacggta tccttttgca
   18201  gaagggcacc gtggcaaccg tttgcggtca gtttgacatt aatttagttt
   18251  ctccgtcttg cgtgtaggtt aatacgcttc tcagaacgta tggttgtatt
   18301  aactaacttt aattcgaaca tatttattgt ttaaagtctg tgagttacga
   18351  tggatgatac tagcggacaa actttcgttt ctgtgaacct ttctgacgaa
   18401  agcaacacgg caagcactaa agttgaaaac gtaaaatcgg aagcggatcg
   18451  cttggagttt ttacgtaaaa tgaatccctt tattgttgac gctctggtgc
   18501  ggaaaaccaa ttatcagggt gctcgctttc gcgcaagaat aataggagtg
   18551  tgcgtggatt gtggtagaaa acacgacaag gcgctcaaga ctgaacgtaa
   18601  gtgtaaggtc aacaacacgc aatctcagaa cgaggtggcg catatgttga
   18651  tgcacgatcc cgttaagtat ttgaacaaaa gaaaggctag agccttttct
   18701  aacgcagaaa tgtttgcgat tgaactggtt tcgtacacca aggaaaggca
   18751  attggcggtc gatttagccg ctgaaaggga gaagacgaga ctggctcgta
   18801  gacacccaat gcgttctccg gaagaaactc cggaatatta taaattcggt
   18851  atgactgcta aggcaatgtt accggacatc aacgccgtag acgttggtga
   18901  taacgaggaa acttcgtcgg agtacccagt gagtctgagt gtttctggcg
   18951  gagttctccg tgaacaccac ttcatctgat tgaagtggac ggaataagtt
   19001  ccttgcggaa ctttaagtcg ggttggtaaa aaccctttat gatggtgatg
   19051  tatcactaga caataaccgg atgggtaaag tctttaaaat gatcgagggg
   19101  aaaattaacc gtatcctctc gttggtctaa gctcccacag agtggtagtg
   19151  gtctcaagtg aggcttaacg tatgcgtgaa ccaaagaagt tctccttaga
   19201  gtgtgtgttg tttacccaac acactgtccc tatggggggc caacataggt
   19251  cca