Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FS703-VT, complete genome.

ACC No: KC517492

Dated: 2013-04-30 | Length: 19240 | CRC: -20493997

                
ID   KC517492; SV 1; linear; genomic RNA; STD; VRL; 19240 BP.
XX
AC   KC517492;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FS703-VT, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19240
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19240
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19240
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata"
FT                   /isolate="FS703-VT"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: VT"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .106
FT   CDS             107. .9451
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30143.1"
FT                   /translation="MSKLGARFKSLTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTKV
FT                   VKEFSAPQPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   VAGIWRYSLCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMKR
FT                   VDPTMHESPQDEIKLKGRRHGKNSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPISF
FT                   GAVPTTAWCSPADAAVLRCRLDYHAAETSFRDERKHVRYVYNDVSSAANRPRTVSPRKC
FT                   GRVFPSGSALGVEVPSTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSGR
FT                   RVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKALGAKVRCLWESSDLDDAKIR
FT                   DGQCYVRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRESLKVPMRGTYT
FT                   FGSVFHCLSTKSFVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVSKPSRAAVRRRNRR
FT                   LREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQLS
FT                   VSIPKRNDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVGG
FT                   LHVFVKRGNFTARFPMSASRYEHHYDASMKGAGLSWVRKSRFPNVEVIRRRRSRTGGSL
FT                   ASFPDANLRINSDQPSDSVQAVPVSGENSPSSRGASSPRRDPVEGSGWYKVGSPSHHSS
FT                   AARGQRSTERGKIGDFSFPSSTVYNAHVDERAYKRVLKLRDTSASSFLRIVLARLSSYR
FT                   PLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGKL
FT                   LQLDSYGFSEDLKDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYGK
FT                   RAVEYGVRGYFSATRLYHCCFTDSPRPFKSLNKYHKMGGEEGALLITDTDRLRAVGSAY
FT                   EKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEFN
FT                   INFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGVHVCRPVYD
FT                   IKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNVLGECFHASDAIVMVQVYDV
FT                   PLRELCRAMVNKKASVCYMTVVTPGELLDARESFFIKELDCSVELDAVADRVIYCFNNS
FT                   AYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEIKRLRYR
FT                   RCDSDLIRIKIPRYSNKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTWN
FT                   YIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAESFSRRLAAFSGDT
FT                   SLFELVRFAISEKCRDLFVGVQEAVERYVKSYLRNSFNISFADLSDPLLTISEYSELDV
FT                   PIDLPGFGCITEGDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLGS
FT                   DGSDSLLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCMAKRLLDLLCERLVGS
FT                   LSRLKFGTTHLTSFFSMLRAKLSRNFFDDSIFTAVWDVVMNLIRIVNGVTRTKLECFRN
FT                   VLRLIPTLCSGCKDFAKDFANMCRLVLLFSTEFFSKSYAKLCRFSLEVFDVGLIEISAR
FT                   NMGLETCVSMASAIFDVVLTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTFGKPEIL
FT                   GEDAFRRTVSMVLSAKAFDKLSIDSKGLVRCSGVIPGVLRIVFSSLFSDADAWVGYSKH
FT                   EVSSLPIITYSAKKLSFALEQTKEACIAFIIDSSKRILASLTSEIHESFQNLELTNGAK
FT                   SLYGHVSSVLSASNSVVSKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEYY
FT                   SASDESELDESLLSDTPGLRGNGKCNDLFRVISGRVSVCCRRAVEALKRLVLHVGDCLY
FT                   SRIMDSFVRLFVETNVAVGKCESFVVDCTRKISDLVIGYITWRNLHSGAYSTTPGLSGG
FT                   SRSSLSRFLDGGLTCVIRSIVTAWLTVFDETFYLSLVHRMRTASINVLLEFLKNLPVCL
FT                   VSIYTFIECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGSLPVCVTRLCNRAFRRGSN
FT                   EGDVRTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSPDSPLFPPTYGEIEELGN
FT                   DSSDSARLIGVDNGLDSVPTESEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFRL
FT                   GLKFVWRMLRNLFNLRAVKFSYGLALQCIFNGGSMGQFTSRLLFSFGNCLPFELFRHVC
FT                   SVRWLSKSLAIRVRNASICDEETVERFFSFSRFLYDSRYLSDVFSVLERVDFYLSYLFS
FT                   LPKRCLTRNRSVRVCARAPVRVIRDMGLVEDGKKSLTEVLNSLDSLKVSDRKGKSALIE
FT                   SDGSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHADALSRLEPDLSGKKDL
FT                   PIVRRSFTRGESSGTKPAGSLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFYY
FT                   SQKVTLYELHGKLSSYWDELKTVGFNRKLAKMDLDDDVDVVDFNLKVIVGRHGTRPFRN
FT                   TVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSLI
FT                   VYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHVV
FT                   KTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQIH
FT                   YIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSIGK
FT                   SSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQG
FT                   ETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEAREI
FT                   FDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGDT
FT                   SEELSSRPFESGCDNITVRDTAPPDSGNLHEPARVRRGKVASNSAKKSVPTRKSSVVRK
FT                   S"
FT   CDS             <9324. .10802
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30144.1"
FT                   /translation="GTLHPLIRVIYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPENFGKVMAAAVIERCFRMDEVAKIRSDIIALTEANIQKWLDKRTPCQVK
FT                   SVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDNLFVGEVDFSKFDKSQDLFV
FT                   KEYERASEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTL
FT                   GILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCSKF
FT                   VVQTGNKTCFVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLKLL
FT                   VETKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICE
FT                   RVVYDNRVGYFSYFDNPFAKPDASDGQADDLATG"
FT   CDS             10851. .11762
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30145.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHIDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPASMRGHYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   NKVCSSSFFFRAVSETATNEFSVVTDDVEDVKYVRKRAEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLTIIFV"
FT   CDS             11832. .11987
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30146.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHATI"
FT   CDS             11993. .13777
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30147.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYTCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LKTVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKRERFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13701. .15311
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30148.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLKSLMTGVEDRKVPDELISV
FT                   DPHEVGCRFTLNDVESYLISRGEDSTDVTAVEHSWCLSNSCGKLLSSTEIDAYKTMVFT
FT                   KTFDSGVFGVTTKLETYLSYCISLYKKHCMKDDDYYNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLIPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAADRVVERPALFNLPQKLLSQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRYMSRD
FT                   VATTGFNLPFHYGRLHDAS"
FT   CDS             15286. .16008
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30149.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIES
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CTARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16100. .16771
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30150.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RRLGTQQNAALNRDLFLTLKEKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16737. .17240
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30151.1"
FT                   /translation="MSGSLGNLTRVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDHLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAISSDRVLFKVIIGTNVDDSRCGCSIWFYDNGMFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17274. .17633
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30152.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHMSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17709. .18257
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30153.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   TMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDISLVSPSCV"
FT   CDS             18339. .18968
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30154.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSLEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPNINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18969. .19240
XX
SQ   Sequence 19240 BP; 4740 A; 3773 C; 4909 G; 5818 T; 0 other;

kc517492 Length: 19240  30-APR-2013  Type: N  Check: 6309  ..

       1  aatttctcaa attcacccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatcccgg caaattgccc actacgccca tacaaacaaa
     101  tataacatgt cgaaactcgg agctcgcttc aagtccttga ctttcgctgt
     151  acgcagcgat tacatcatct cgcgcatctg gcgcgccttt aacaccgttg
     201  gagtcctgca cttcttcggt actgaaacaa ccaccaaggt ggttaaggaa
     251  ttttcggctc ctcagccgat agtccctcta cggaaatcct gttttccgtt
     301  ttctgttcgc gctgctgttc gcgcgattaa agctgccgga cgtcccattg
     351  acgctccgcg ctctggatgc ctctgtggcc tccctgttat cgacacatct
     401  ggtgtcgtac gtccccgtgt cgcgggcatt tggaggtatt ctctgtgtaa
     451  acctcccctt actgccgccg ccaagaagtc cattcgcaag gcgaagaaag
     501  attctgcttt ctttcttagc cgggcttctt cactcttctc acgggaagtc
     551  ccctgcggca cgcgtcatag acttcgtagg cgcgttatga aacgagtaga
     601  ccctaccatg cacgagagtc cccaagacga gatcaaactt aagggacgcc
     651  gacatggcaa gaattctgac ctcccgtata tgggggaagc ggcgttggat
     701  gatatccttc gctggattga gggggtaaat cccccgccgt cgatggtcgc
     751  cattccggtg cccatctctt tcggcgccgt gcccacaacg gcatggtgct
     801  ctcctgctga cgcggctgtt ttgcggtgtc gtttagacta ccacgccgct
     851  gagacttcct ttcgtgacga aaggaagcac gtgagatacg tctataatga
     901  cgtgtcttct gctgccaacc gtcctcgtac ggtttctccc cgcaagtgcg
     951  ggcgtgtttt ccccagcggt tctgcgctgg gtgttgaggt cccgagcact
    1001  agggatcgcc ataccgcttt cgtgagatct actcacgcta gcgttttctt
    1051  ctccgacgcg gttcgccgcg ttcgcatgtt ccgtcctggg cggaataatt
    1101  tcttcactag cgtcgttagt gggcggcgcg ttagttactt tagacccgga
    1151  cctaatggta cggtgtctgt tttaatgtcg gacggtgtca acacggcacg
    1201  tctcgacgtt gttgctcctg cgtactatgc gtacgctaaa gcgttaggcg
    1251  ccaaagtgcg ctgtttgtgg gagtcgtccg atttggacga tgctaagata
    1301  cgtgacggcc agtgctacgt tcgtcacgta tacgacgtgg ccctttactt
    1351  cggaaggcgc gtcgatcttt ctgtgcgccg aactttgggt ttgtttccca
    1401  cagtgggtgc actaaaagct tatcttgttc gcgagtacgg tcgcgaatct
    1451  ttgaaggttc cgatgcgcgg gacttacact tttggcagtg tgtttcattg
    1501  cctgtcgact aaatcttttg tcgacttgag atctattcct aaccatcact
    1551  tggttggtgg tgcgtctgct catgtgttta ttgggcagat tcgtgttgac
    1601  gttcctggtg gtgtctctaa gccatcacga gcagctgttc gcaggcgtaa
    1651  taggcgtttg cgtgaagacg ggtttttagg tagtaccgat tcgtcttctt
    1701  caggagggtc gagatactgt tcggattgtt caactcctcg cagtccaccc
    1751  tctccgtcga ttgttggacc aactcttggc cggataccaa gtataaaccg
    1801  gaagttccgg tttccagcag gcactcagtt gagtgtttct atccctaaac
    1851  gcaatgatga tcgcgtgtac gtgtcggtcg gccaagactt tgatgagttg
    1901  tgccatgccg tgtgtaccta cgttaagagg tacaactcga gaaaagcatt
    1951  ttacacgcgg tttgaaaatg gtgatgattt cgccgtcatt cggcgtgctt
    2001  ccgtcggagg tcttcacgtg ttcgtgaaac gcggtaactt tacggctcgg
    2051  ttccctatgt cggcttcaag gtatgagcat cattatgatg caagtatgaa
    2101  aggcgccggt ttgtcgtggg tgcggaagag tcggtttccg aatgttgaag
    2151  ttatacgccg tcgaaggagt cggacgggcg gttctttggc tagctttccg
    2201  gacgcgaatt tacggattaa ttctgaccaa ccgtcggatt ctgttcaggc
    2251  agttccggtg tcgggtgaga attctccatc gtctcgagga gcgtcttcgc
    2301  cccgacgtga tcctgttgaa gggtcgggct ggtataaggt gggttctcct
    2351  agtcatcact cgagtgccgc tcgtgggcaa cgttccactg aacgtgggaa
    2401  gattggggat ttcagttttc cgagtagcac cgtgtataat gcacatgtag
    2451  acgagcgtgc ttataaacgt gtgttgaaat tgcgggacac gtcggcgtcc
    2501  tcttttcttc gtatagtttt ggctcgtttg tcgagttatc ggcctcttag
    2551  tgacgagttc tttaacaagt gcgttacttc tcggttcgta gcttgtatcg
    2601  aggcggttga atcgggtctc gttacagtac actttcgatc cgacgtgttt
    2651  cgcgcctcgt tcccgtttgg cgtttatttg tatactcgtc acgcgtttga
    2701  tatttacagt ggtaagctcc tgcaactaga tagctacggg ttctcggaag
    2751  acctgaagga cggttactgc tatattcgtc atatcgctga ggtctgtttg
    2801  agtatgggaa aagttttctt taggagggac gttaacttag gggcgttccc
    2851  ttatgttttc gaggtacagc accgtcttga gcggttgtac ggtaagcggg
    2901  ctgttgaata cggcgttaga ggatattttt cagcaacgcg tctttaccac
    2951  tgttgcttta ccgattcgcc gagacccttc aaatctttaa ataagtatca
    3001  taagatgggt ggtgaagaag gtgcgttatt aatcactgac actgatagat
    3051  tacgtgccgt ggggagtgct tacgaaaagg tgaaggggcg tttgcctgat
    3101  tctttacttg ttcgatcggt ggagaaagat ttgatagaat tcaatcaaac
    3151  tctggttgat acgcaacggg ctagacctgg tgttgcagta ccttttcaga
    3201  tgagtgagaa ccaacaggtg atgctcacta gagcttatcc tgagtttaat
    3251  ataaacttta ctcattccgt acactccgat caccccgtgg ctgcgggttc
    3301  tagaatgtta gagaatcacc ttgttcgtaa atacgcaggt agcgattatt
    3351  cggacgtagg tggttgccca ttatttcatt tacgtgcggg tcatacagga
    3401  gttcacgttt gcagaccagt gtacgatatt aaagacgccc accgtagagt
    3451  cgttcgtcat catcaactta gtaaagtagc ttttgatcac actgacgggt
    3501  ctaagcaggt tggtgctgtc aatacgaaca ccgtgtgtgg taacgtttta
    3551  ggggagtgtt ttcatgcgtc tgatgcgatt gttatggtgc aagtttatga
    3601  cgtgccattg cgagagttgt gtagagctat ggtgaacaag aaagcttcgg
    3651  tgtgttatat gaccgtggtt acgcctggtg agctgttgga cgcccgtgag
    3701  tccttcttca tcaaagagtt agactgttcg gtggagttgg acgctgtcgc
    3751  cgatagggtt atctactgtt ttaacaattc agcgtatacg cacacctatt
    3801  ctacgatatg cgaatacatg cgtactcctt gtgtggtggt ggatggtttt
    3851  ctgttcacta tagagatggt ttcactcaga tgcagcgtta actattattg
    3901  tatcaccaag tcgcgggttt gtccgagaat cagcgagatt aaacggttac
    3951  gctatcgtcg gtgtgatagt gacttgatca ggatcaagat tcctcggtac
    4001  tctaataaga ctcgtagttg tttaccaggg tgttattatt tgtatttaga
    4051  cgctaagttc gtgagtcgtg tgtacgaata cgtggttaat aattgtgttg
    4101  tggtgaatgc taagactttt gaatggactt ggaactacat caagtcctgt
    4151  aagtcaagag tggtcatcag tgggaagatc atccataggg acgttcctat
    4201  tgcgttggag tatttggatg ggttttccgc agttatgttg tccgcgggcg
    4251  tgaaaggtag gcagaacgcg gaatcgtttt ctaggcgtct agcggccttt
    4301  tcaggcgaca cttctctttt cgaattggtg aggttcgcca tttcagagaa
    4351  gtgtcgcgat ttatttgtgg gcgttcagga ggccgtagag agatacgtga
    4401  aatcgtacct cagaaactcg tttaatataa gtttcgcgga cttgtcagat
    4451  ccgttgctta ccattagtga gtattcggag ttagacgttc ctatcgattt
    4501  gccgggtttt ggctgcataa cggaaggaga tgaggctaaa ctcatagaag
    4551  atggggttaa gtcggcttta ctgcgaaaag cagttcgtga cgaggcgcaa
    4601  ctcattctcg aaaggggcgg tacgtcagag atcgttcctt gtggggatga
    4651  tgatggttta ggcagcgacg gttctgacag tttactcggg tccggtagtg
    4701  attcgtcttc taaagccagt tctggtggtt tgcgggccgg ggccgcccct
    4751  tcactgttca gaagcttgtt gaagaagttg ggtgggggtt tttgtatggc
    4801  caagaggtta ttggacttgt tgtgcgagcg attagttggt tcgttgtcgc
    4851  gcttaaagtt cggtaccact catttaacct cattctttag catgttacgc
    4901  gctaagcttt cgcgtaattt cttcgacgat tcgattttta ccgctgtttg
    4951  ggacgtggtg atgaatttga ttagaatcgt caacggggtg accaggacga
    5001  aattggagtg ttttcgcaat gttcttcggt taattcctac gttgtgttct
    5051  ggttgtaagg acttcgcaaa agactttgca aacatgtgta ggttagtttt
    5101  gctattttct acggagttct tcagtaaaag ctatgctaaa ctgtgtcggt
    5151  ttagtttgga agtattcgat gtcggactca ttgagatttc agcgcgtaac
    5201  atgggactag agacttgtgt ttcgatggct tcagccattt ttgacgtcgt
    5251  acttacctat cctctgggaa gtattagctt tcccgtcgta tgcgcgagag
    5301  tttttggcgc cctcgctatg gaagtgggat caaactattg ttttaagaaa
    5351  actttcggca aacctgaaat tttaggagag gacgcttttc gtagaacggt
    5401  aagtatggtg ttgagcgcta aggctttcga caaactgtcg atcgacagta
    5451  agggtttagt taggtgttcc ggtgttattc ctggagtttt gaggatagtg
    5501  ttttcgtctc tgttttccga tgccgacgcg tgggtgggtt atagcaaaca
    5551  cgaagtttcc tcacttccca taatcacgta tagcgcgaaa aagttatctt
    5601  tcgcgttgga gcagactaag gaagcgtgca tcgcctttat aatcgattcg
    5651  tctaagagga tcttagcgtc tttgacctcg gagattcacg agtctttcca
    5701  aaatttggaa ctaactaatg gtgctaagtc cttgtatgga catgtgagtt
    5751  ctgtactctc agcgtctaat agtgtggtta gcaaggcagg aaacgccgtt
    5801  gcagcagtta aagcggcggg gagtggtctt agtaaacgtg tgaggcgcat
    5851  tcgtccttct tttcgcctag ctcggtgtgt taatgaacag accagcgaat
    5901  actattctgc tagtgacgaa tctgagttgg acgagtcgtt gcttagtgac
    5951  acgcccggtc ttcgtggtaa cgggaagtgt aacgatttgt ttcgtgtcat
    6001  ttccggacgt gtttcggtat gttgtaggcg cgctgtagaa gccttgaagc
    6051  gtttagtcct acacgtcggt gactgcttgt actcgcgcat tatggactct
    6101  tttgtgaggt tatttgttga aaccaatgtt gcagtcggga agtgtgaatc
    6151  tttcgtcgtc gactgtaccc gaaaaatttc tgatttagta atcgggtata
    6201  ttacttggcg caatcttcat tccggtgcgt actcgacgac tccagggtta
    6251  tctggtggta gtaggagttc tctttccagg ttcttggatg gtggtctcac
    6301  gtgtgtaatt cgaagtattg ttaccgcgtg gttgacggtt ttcgatgaga
    6351  ccttttattt gagtctagtc catcggatga ggactgcctc gataaatgtg
    6401  ttgttagaat tcttgaagaa cctcccggtt tgtttagttt cgatatacac
    6451  tttcatagag tgtagatcta ggattttccc tttgaaggaa tttctttggg
    6501  gcttttgcgt ttttgtttgg aacattgtta aggaactttc catatgcatt
    6551  tacggaagtc tccccgtttg cgttacgagg ttgtgtaata gggcgttccg
    6601  tcgcggttcc aacgaaggtg acgtgcgtac gcttcaagtg atcaccgaag
    6651  ccgaaaaccg aatcgagttt ttgcgagaag ttctcgccga aatggcacgg
    6701  tatcgtgctt ctctcgagat acccgtacca gggtcgcctg atagtccttt
    6751  gtttccacca acgtacggcg agattgagga gttaggtaac gattcctctg
    6801  acagtgcccg attgataggt gtggacaatg gtttagattc agtgcccact
    6851  gaaagcgaag cagaactaga ttcggatggt gatagcgacg actcaatacc
    6901  tttggatcgc gactttgagc aaatcggagg tcttggcgga agcggtaacg
    6951  ttgacgtctt tcgtttaggg ctgaagttcg tgtggaggat gttgcgtaat
    7001  ttgtttaact taagagccgt taaattctcc tatgggttag ctcttcagtg
    7051  tatatttaac ggcggttcaa tgggccagtt tacgtcgcga ctgttattca
    7101  gtttcggcaa ctgcttaccg tttgagctct ttagacatgt ttgtagtgtg
    7151  aggtggctgt caaagagctt agcaatacgt gttcgtaacg ctagtatttg
    7201  tgacgaagaa acggtcgaac gtttcttcag tttttcgcga tttttgtacg
    7251  attcgcgtta cttatcggac gtgttttcgg tgttggagag ggtcgatttt
    7301  tacttaagtt atctattctc gttgccgaag aggtgtctta cgcgtaaccg
    7351  tagtgtccga gtttgcgctc gagcgccagt tcgcgtgatt agggacatgg
    7401  gacttgtgga agacggcaag aagtctttaa ccgaagtgtt gaactctttg
    7451  gactcattga aagtgtccga ccgtaaaggg aagtcagcac ttattgaaag
    7501  tgatggttcc gactccgaga gcggtcattc attcggttcc atttcattcg
    7551  gatcggttaa tgaggaagtt ttagaagcag tgaacggtgg tgtcgtatcc
    7601  gaaaaagctc cactgatgaa gcatgcggat gcactaagca ggttggagcc
    7651  agaccttagt ggtaaaaagg atcttcctat tgtcaggaga agttttaccc
    7701  gcggtgaatc ttcaggtacg aaaccggcag gaagcttgtg cgtgtactta
    7751  acgacgttga attcttcatt cggttcggtg cctgacctgt atcccgtcgc
    7801  acgtgacata acgtacaaga agatgaccaa tgccatgcgc gagttttatt
    7851  actcgcaaaa ggtaacgttg tacgaacttc atggaaaatt gagctcgtac
    7901  tgggatgaat tgaagacggt aggttttaat aggaagttgg cgaagatgga
    7951  tttagacgat gacgttgatg tcgtcgattt taacttgaag gtaatagtgg
    8001  ggaggcatgg tacccgtcct ttcagaaata ctgtgaactc tcacgagttc
    8051  atgttttgtg atgacgggtt ggtgctttgc ccgggaccga aaaaacgtga
    8101  ctttgctctg atctctagtc aaacgcaatt cgttgctgcg aactcattct
    8151  tgcgtgccgt ggacggtaaa gatttgacgt tcactaattc ggagcatagt
    8201  ctcatagttt atgaggctcc tcccggtggt ggaaagacgc attctttggt
    8251  aacgtatttc gccgattatt gtaccaaagt gtcttgcttg gtggtgaccg
    8301  ctaacaaaaa ttcgcaagcg gagatttctc aaagaatctc tagagagtta
    8351  atggatagaa agatgcttgc taaacacgtt gttaaaaccg ccggtagagt
    8401  gttcactgtg gactcttatc tgatgaacca tattcgactc aagactgatt
    8451  tgttgtttgt cgatgagtgt tttatggttc atgctggagc aatcggagcg
    8501  gttgttgagt tcacttcatg taaggctgtg gttttcttcg gtgatagtag
    8551  acaaattcat tatattcacc ggaacgattt tggtgtttca ttgttgcatg
    8601  acatagacgc atttatagag ccacagcacc gcatttacgg tgaggtgtcc
    8651  tacaggtgtc cttgggacat ctgtgagtgg ttgtctaaat tctatccgag
    8701  acatgtggcc actgctaaca ctggtagtat cgggaaatcg agtgtgtcta
    8751  tagagataat taatgggtgt gacgatgttc cttacgatag tagcgcgaag
    8801  tacatcgttt acacacaagc agaaaagaac gaactgcaaa agcaccttgg
    8851  tcgtttaacc gtaggccgaa ctaaagcggt gcctattgtg aacacagtgc
    8901  atgaagttca aggtgaaaca tataagaagg ttcgtttggt aaggtgcaaa
    8951  taccaagagg acactccttt ctgttcagat aatcatgttg ttgtggcttt
    9001  aaccaggcac gtcgactcct taacttactc cgttttgaat agcaggagat
    9051  acgacaagac cgcttccagt atagatgaag cgagggagat ttttgacaaa
    9101  tttcgttcga cgaaccattc tcacggttct tcgacgttgg aatggtacct
    9151  tgagaaatac cctactgaat ataagggtag taaagcatct tcggcgccat
    9201  taagttgtat taatgagttt cttaacgagg tcgttgtcgg ttcttcagtt
    9251  gtgcagttgg gagatacttc agaagaatta agttctcgtc cttttgagtc
    9301  tggatgtgac aatattaccg taagggacac tgcaccccct gattcgggta
    9351  atctacacga accggctcgc gttcggcgtg gtaaggtcgc aagcaattcc
    9401  gccaagaaaa gcgtccctac aagaaaatct tctgtcgtac gaaagtcgta
    9451  attacaactt tataaagacg gagcgatttg tggggcccga aaatttcggc
    9501  aaagtcatgg ctgcggctgt tattgagagg tgttttagga tggacgaagt
    9551  ggccaagata agaagtgata ttattgcttt gactgaagcc aatattcaaa
    9601  agtggctcga taaacgtact ccgtgtcagg taaaatctgt gcaggccgaa
    9651  ttgaagttac cgtttgctgt ggaagagcaa atcaccaact acaaactaat
    9701  ggttaagcgt gatgccaaag taaagctcga tgattcgagt ctgtccaagc
    9751  accctgccgc acagaatatt atgtttcata agaagtttat taatgctatt
    9801  tattctccat gcttcgacga atttaagaat agggtgttgt cgtcactaaa
    9851  cggtaatata gtgttcttta ccgaaatgac gaacgctgga ttggcggaag
    9901  tcattagaag gattataggt gatgacgata atcttttcgt tggggaagtg
    9951  gatttcagta agttcgataa gtctcaagat ttgtttgtta aggagtacga
   10001  gcgtgcttct gagttcggat ttgatgacga acttctcgac gtgtggatgg
   10051  aaggcgaata ccgcgctagg gctaccacgt tagacggtca actgagtttt
   10101  tcggtcgacg gtcaacgtcg ttcgggaggt tcgaacacat ggattgggaa
   10151  ctctttggtt accctgggta tcctatcctt gtattatgac gtctcaaagt
   10201  tcgagctact gcttatatct ggtgacgact ctctgatcta ttcaaaagaa
   10251  aagattagta acttttcttc agaaatttgt ctggagacag gttttgaaac
   10301  taagtttatg tctcctagcg taccatactt ttgttcgaag tttgtggttc
   10351  agacagggaa caaaacgtgt tttgtaccgg acccttacaa gttgttggtt
   10401  aaactggggg ctccccaata caaattgact gatgacgaac tcttcgaatt
   10451  gttcacttcc tttaaagaca tcactcagga ctttggtgat caggtggtcc
   10501  tagagaaatt gaagttgtta gtagagacta agtacggctt tactagcgga
   10551  actactatgc ccgctctatg tgctatacat tgtgtacggt ctaattattt
   10601  gtcttttgaa aggttgtttc cctttattag aggttggtat gttgttgacg
   10651  ctttgaagct tagacaactg aggaaattcg ccaatttgat ctgtgaacgt
   10701  gtggtttacg ataatcgcgt gggttatttt tcgtactttg acaatccgtt
   10751  tgctaaaccc gacgctagcg atggtcaagc cgatgactta gcgacaggct
   10801  gatagtttgt tcagttctcg ctgagagcta acacaggtag ttgagtcgag
   10851  atgtttgcct tcgcgagcga aaaccaagac atattagaag aaaagatttt
   10901  tcgccgtaga acctgccatc gtaagtattt ggatgacgtg gttagggact
   10951  ttaccattga tattggttat gatactgtcg atcgtgatcc tacggtattg
   11001  gctgattatt tctcgttgta tttctttttg cttaacaatg ataacattgg
   11051  gcctttagca gcttcgatta tagtaagccc accagtaagc gggactcata
   11101  aaattcgagc gcacatcgat aatcaaccga atcgtgaagg aaacgttact
   11151  tacgttaaga ctgttgataa gagtcgtttt gtgattcgca taaaagcgat
   11201  gccagcttct atgagaggcc actactcctt tcgggcgttt gttagtggtg
   11251  acgtcgctag cgaacgtagt gagtttatat gcagttttgt tggtagtagg
   11301  tttctttgtt gttgcacaca aacaatatcc gaaaatttga acaaggtttg
   11351  ttcgtcttcc ttcttcttta gagctgtttc ggaaactgct actaatgagt
   11401  tttctgttgt gactgatgat gtagaagacg ttaagtacgt aagaaagcga
   11451  gccgagggtt tttcacattg cgctgacccg tatccaccta ggtgttatcg
   11501  taacgctaat ttaggtgata gttcaggggt ccaaagtcgc acgattgaag
   11551  aggaaggtta taggacggac actgtaggta acgtcgcggt taccgttccg
   11601  aacactccac tcgttaatgc cgtctctccg tatgtcgcgg agtacaacga
   11651  aaatacgcgt tcgcgtatct cgttaatacg gcgagtctgc tgttacgccg
   11701  tctgtgtttt agtggtttct cttcttataa tgagcggttt gttgactatc
   11751  atattcgtat gacttggtgt agtaacttat ggggtatggt tagctaaaac
   11801  tcaccgtttg actctgttta aacggggttc aatggactgt gtaattcaag
   11851  gatttttgac ttttctagtt ggtatagctg tgttttcggc ttttgccgga
   11901  ctaattatca ttgttataac gatttatcgg tgcacgacta agcccgttag
   11951  aaacgcctct ccttacggca ctcacgccac tatttaagcg gtatggtgct
   12001  tctgggttta gactttggta ccacgttttc gacggtggct atggctacat
   12051  cttctgagtt agtaatactt aaacaatcca attcgtcgta catacctacg
   12101  tgtttgtttc tgcatgcaga tcctaacagc gtgtcttatg gttacgatgc
   12151  ggagtactta gcggcttcgg gggaacctgg ctcgttttac aaagatttga
   12201  aacggtgggt cggttgtact gagaagaact accaaagtta tttgcacaag
   12251  ttatcacctt cctataaggt gatagtaaaa gagttcggaa ttaagagtat
   12301  gccggttccg tatttgtcac ctcttaataa tgatcttggg ctcagtgtcg
   12351  ctttgccttc tttgatcgct ttatatacca aatcgatttt atcggatgcg
   12401  gagagagtgt tcaacgtgag ttgcactgga gttatatgtt cggtacctgc
   12451  tggttataac acgttacaac gagcttttac acaacaaagt gtgtccttgt
   12501  cgggttatac ttgcgtgtac attattaatg aaccttccgc tgccgcttac
   12551  tccactttac ctaagttgag ttcggcggat aagtacttgg ccgtttacga
   12601  cttcggcggt gggacctttg atgtttctat agttagtgtt aggttaccca
   12651  cgttcgccgt tagaagttcg ggtggtgata tgaacttagg cggtagagac
   12701  atcgatagaa agttatctga taaaatatat gagttggctg attttttacc
   12751  gcaaaaagaa ctgaacgttt ccagtttaaa ggaagcttta tctcttcaaa
   12801  cagatccagt caagtatact gtaactcatt acgggatgag tgaaaccgta
   12851  tcaatcgatc aaacgacgtt gagggagata gcttcggtat ttataactcg
   12901  aacgatagac atacttacac aagttaaagc taagtctagt atgcccgagt
   12951  cgcaaagttt gaagctagtg gtagtcggtg gaagctcgta cctaccaggg
   13001  ttgttggata ctttgaaaac tgtacctttt gtgtctggga tagtaccagt
   13051  ggaagacgca agaaccgccg ttgctagggg gtgcgcttta tatagcgagt
   13101  gtttggatgg taggtccaag gccttactaa tagattgcat tacgcatcat
   13151  ttgtcggtta cgacatttag cgcagactcg gttgttgttg ctgcggccgg
   13201  aagtccaatt ccttttgaag gagaacgcaa actcacgttg cgtaagtgtg
   13251  ttagtacatc gaattatcaa gcaaggatgt tcgaaggaga ttacgaaaaa
   13301  gtttttcgaa acgaacgtat atacgcagct tcggtgtcat tgtttacttt
   13351  gggagttaac tggcgcgtgc ctaacgacgt tgagatgact ctcgtgacca
   13401  aagtggactc aatgggtaaa gtggaattct accttaaagg tccatctggt
   13451  gaattagtta acgtgcaagg tacttcacat tatgattatg ttggtatgcc
   13501  tcatcccact agaaagttgt tgaggcttag cgattacaat gtaaactccg
   13551  ccgctttagt tttagctttg acattgactc gcgaaaaacg agaaagattt
   13601  cttttgcgaa ctttatttga tactttacta gcggacttgc gaaagaccgc
   13651  aagtttaagc gaatattcta agaaatatcc gattactcga aacgacattg
   13701  atgtcgtctc atcacgtatg gggatcgttg tttcgaaagt tttacgggga
   13751  agcgatttgg aaagagtacc tctctgaatc aactcgaaat ttcgacgaga
   13801  gaaacgtatc gttagaccac actctaagtt cgggtgtggt cgtccgtagg
   13851  cagagtcttt tgaacgcgcc tcaaggaact ttcgagaatg agttagcgct
   13901  attatacaat tcggtggtaa ttaacgattt tgttgaatta actggtatgc
   13951  cgttgaagtc tttgatgaca ggtgttgagg accgtaaggt acctgacgag
   14001  ttaatatccg ttgacccgca tgaagttggg tgtagattca cgttgaatga
   14051  tgtagaatca tatttaataa gcaggggcga ggattccact gatgtaacag
   14101  cggttgagca ctcgtggtgt ttgagcaatt cttgtggtaa attgttaagt
   14151  tcgaccgaaa tagatgctta caaaaccatg gtgtttacta agacttttga
   14201  tagtggtgta ttcggggtga ccactaaatt agagacgtat ctatcgtatt
   14251  gcatatcgtt gtacaagaaa cattgtatga aagacgatga ctactataac
   14301  cttatattac ctatgtttaa ttgtttgatg aaagtgctgg cgtcgcttgg
   14351  tttgttttac gaaaaacata ctgacaatcc gctgctgacc ggcatgctca
   14401  tagagttttg cctagagaat aaggtgtatt actctacttt taaagtaaat
   14451  ttggacaacg ttaggctgtt taagtctaaa gtgttgcctg tggtgttaac
   14501  agtctgggat atatctgagc ctgatgaccc ggtggatgag agaacgctaa
   14551  ttcctttcga ccctacggat ttcgtgcttg atatacccaa actgaatata
   14601  cacgacacta tggtggtggt gggtaatcaa atcagacact tagagcacgt
   14651  ggttgagagc gatgcattag acgacttgtc tcaacatgtt gacttgaatt
   14701  tagcagcgga caatcccgat ctacgtgttg atttgcgttg ggcagggatg
   14751  tttgtgtatt acggcatata tcggtgtgct gcagatagag tggtggaacg
   14801  accggcatta tttaatctac cgcagaagtt gttgagtcaa gacgacggtg
   14851  aatcatgctt gttgcgtatg agttccgttg aaaccttatt caatctggtg
   14901  caaaaggtga ataaggacat aaatattagg cgtcaattca tgggacgtca
   14951  tagtaaagtg gctttgcggt tgtatcgcaa tttaggtttg aagtttcctc
   15001  caatttcctc agttaggttg ccagctcatc acggctactt atacgtcgat
   15051  ttttacaaaa gaatacctga taatgctgtt gacgccgacg aacttgaaag
   15101  tttacgtcaa ttacgttcgt ccgtagacgt tatgtgtaag gacagagtgt
   15151  caatcacgcc tccaccgttt aatcgacata gaaggggttc ttctagaata
   15201  cttagaggtc gaggcgcacg cggtgcgagc tcgcgttata tgagcagaga
   15251  cgtggcaact accggtttta acttaccctt tcattatggc aggttacacg
   15301  atgcttccta aaactgatga caaagaaatg gatccggtga gtgccgctgt
   15351  gcccggtaaa tacccggacg ttattgaaaa atttgtgacc aacaggtcag
   15401  tagatgcgtt aatagaaagc gttattagca agttggatac taattcaata
   15451  tacgaagatt ccactgaaaa atttactggt gagcaactga agtacgtcat
   15501  ggttactatg gacactttct tactagaaaa ttacaaaacg aaaacggaag
   15551  atctgctggt tcacttggct atgattcaaa agaggttgtg cactatatct
   15601  acgagtacta aaaccaagtt tcgtgataaa ggttgtatca gttatgtaca
   15651  agggggttta cgatataagt taatggataa ggtagttttt ccctttatta
   15701  tatctaagtt tactgacagg gagactccaa acgctctacg taagtatgct
   15751  tgtacttttg aggagttaca cttgtgcacg gctaggttga gacccgactt
   15801  gtacgaaaac aaaaggacga ccaaagctgg gactccgcat ttaaagggct
   15851  acttatcagc cgactttctt acgggttccc tcccaggata ttccgaacat
   15901  gaacggggta tcattcttcg agcgtcagaa tctatgttag ctagacgtca
   15951  aggttatgag gaagcaaccg agcttcttaa cttacgcgat ttaggaaagt
   16001  atttgtagtt tgtttgcgga cggtggtatt acgccatccc atgagcactg
   16051  ctttaagggt cgttaattga cgactcttga tatttactaa gtttgagtta
   16101  tggacgacga gacaaagaaa ttgaagaaca aaaacaagga aacgaaagaa
   16151  ggcgacaatg ttgttgcagc ggagtcttct ttcggttctg taaacttaca
   16201  catcgatccg actctgatag cgatgaacga tgtgcgtcgg ttgggtaccc
   16251  aacagaatgc cgctttgaac agagatttgt ttcttacttt gaaagagaag
   16301  tatcctaatt tgtctgataa agataaggac tttcacttag ctatgatgtt
   16351  gtatcgttta gcggttaaga gttcatcatt gcaaagcgat gacgacacta
   16401  cgggtataac gtacactcgg gagggcgtcg aagtggattt gtctgacaaa
   16451  ctttggactg acgtcgtgtt taattctaag ggtatcggta accgtactaa
   16501  cgcccttcga gtctggggta ggactaacga tgccctttat ttagcctttt
   16551  gtagacagaa tcgcaatttg agttatggcg gacgtccgct agatgcaggg
   16601  attccggccg ggtatcatta cctgtgtgca gatttcttga ccggagctgg
   16651  cttgactgat ttagagtgtg ctgtgtacat acaagctaaa gaacaattgt
   16701  tgaagaagcg aggggctgat gaagtcgtag ttaccaatgt caggcagctt
   16751  gggaaattta acacgcgttg atctattgcg ttctgattcc cggtttctat
   16801  cgggatggtg gagtttcatc gtgaacgtgg gtgatataat cgttcggttc
   16851  gcgttacacg ttcctagtga agatgtgctg aatagctttt cagctatatc
   16901  gaattgtacg atcatagcgg acggtagtgc tttactaaaa gacaacactg
   16951  tggttgacca tttagagagc atgaaccctt tggcttattt gttaaaatta
   17001  gcgaaaacga ctactactat ttgttttact atgtctaata aggttctttt
   17051  tggtactact aaatccgaac cgcttagttg tttagctatc tcgtcggacc
   17101  gagttttatt caaagttatt ataggtacta acgttgatga ttctcgatgt
   17151  ggctgcagta tttggtttta cgacaatggg atgtttcaaa atgggttgac
   17201  ccgttgtaat aatctcgtcg ctttgtttag cgcgacttag acacgaagtg
   17251  accgttcggg tttaattgct gcaatgagta ttcgacgtgt gtggttaaag
   17301  gtaatggctg taattacggt attgtggtat ggtaaagaac cttccattag
   17351  cgaaggttac aacgctctta tgaatgatga ctttaagttt atcgatacgc
   17401  atttttcaaa cgtctcttat gctaagaaat gttacgaatt ggctaatttc
   17451  gatttagact ttctacgcat cgttatcatt cccttaagtg gtggtgcggt
   17501  gaatgaatcg cgtgctgatc gcgctaacgt ttctgagatt gtcgaatcgc
   17551  atatgagcga tcgagacaga atgaatatct tattgcgtaa taagcggatc
   17601  cagattcctt cgctcttacc ttgcgataac tagagtctac tcagtagtac
   17651  gtctactagt ataacgtatt gaacacttta gtgaggagtt ttgtttaaac
   17701  caaacaatat gcgagcttac tttagtgtta acgattacat aagccttttg
   17751  gctaaggtcg gcgcagttgt ggaacgttta tgcgatccaa gcgtaactct
   17801  cacggaagtg atggacgaaa ttaatgattt taactcgttt ctcgctttgg
   17851  tacactctat gaagtcggac atgaacggcg atcatcagga tggtcaccat
   17901  gagatgggtg aacacaagtc tcgattgttg tgcaatatag aagcgaaact
   17951  gcgaatactt ctcgacatca taagacgtcg gtttactcgt gacaagctac
   18001  tctgtaccag cgcaacagat accatgggct tcttcgttat gaggtacatg
   18051  agttctagtc acaccagttt cgagtccgta atgcgaacgg agctgaaatt
   18101  agtggttaaa gcggtactgt cggatttatc ccgcacgcat aaactagact
   18151  ttagcgagcg agcctttgca gcttacggta tccttttaca aaagggtact
   18201  gtagcgactg tttgcggtca gtttgacatt agtttagttt ctccatcttg
   18251  cgtgtaggtt aatacgcttc tcagaacgtg tggttgtatt aactaacttt
   18301  aattcgaaca aattattgtt aagagtctgc gagttacgat ggacgatact
   18351  agcggacaaa ctttcatttc tgtgaacctt tctgacgaaa gcaacacagc
   18401  tagcactgaa gtcaaaaccg taagtttgga agcggatcgc ttggaatttt
   18451  tacggaaaat gaatcccttt attatcgacg ctttgatacg gaaaaccagt
   18501  tatcaaggtg ctcgctttcg cgcgagaata ataggagtgt gcgtggattg
   18551  tggtagaaaa cacgataagg catcgaggac tgaacgtaag tgtaaagtca
   18601  acaacacaca atctcagaac gaggtggcgc atatgttaat gcacgatccc
   18651  gtgaaatatt taaataaaag aaaagctaga gctttttcta acgcagagat
   18701  gtttgcgatc gatttggtta tgcataccaa agaaaggcaa ttagcggttg
   18751  atttggccgc tgaaagggag aagacgagat tggctcgtag acacccgatg
   18801  cgttctccgg aggaaactcc ggaacattat aagttcggta tgactgctaa
   18851  ggcaatgtta ccgaacatca acgctataga cgttggtgat aacgaagaca
   18901  cttcgtcgga atacccagtg agtctgagtg tttcaggcgg agttctccgt
   18951  gaacaccact tcatctgatt gaagtggacg gaataagttc cttgcggaac
   19001  tttatgtcgg gttggtaaaa acccttatga tggtgatgta tcactagaca
   19051  ataaccggat gggtaaagtc tttaaaatga tcgaggggaa aattaaccat
   19101  atcctctcgt tggtctaagc tcccacagag tggtagtggt ctcaagtgag
   19151  gcttaacgta tgcgtgaacc aaagaagttc tccttagagt gtgtgttgtt
   19201  taccaacaca ctgtccctat ggggggccaa cataggtcca