Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate FL202-VT, complete genome.

ACC No: KC517493

Dated: 2013-04-30 | Length: 19249 | CRC: -168305840

                
ID   KC517493; SV 1; linear; genomic RNA; STD; VRL; 19249 BP.
XX
AC   KC517493;
XX
DT   30-APR-2013 (Rel. 116, Created)
DT   30-APR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate FL202-VT, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19249
RA   Harper S.J., Hilf M.E.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19249
RA   Harper S.J., Hilf M.E.;
RT   ;
RL   Submitted (23-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: CLC Genomics Workbench v. 6.0
CC   Sequencing Technology :: SOLiD
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19249
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="FL202-VT"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="02-Feb-2012"
FT                   /note="genotype: VT"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .106
FT   CDS             107. .9454
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK30155.1"
FT                   /translation="MSKLGARFKSSTFAVRSDYIISRIWRAFNTVGVLHFFGTETTTTV
FT                   VKEFSAPQPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVIDTSGVVRPR
FT                   SVAGIWRYSLCKPPLTAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVMK
FT                   RVDPTMHESPQDEIKHKGRRHGKTSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGAVPTTAWCSPADAAVLRCRLDYHAAETSFRDERKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPNTRDRHTAFVRSTHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVSYFRPGPNGTVSVLMSDGVNTARLDVVAPAYYAYAKALGAKVRCLWESSDLDDAKI
FT                   RDGQCYVRHVYDVALYFGRRVDLSVRRTLGLFPTVGALKAYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSFVDLRSIPNHHLVGGASAHVFIGQIRVDVPGGVSKPSRAAVRRRNR
FT                   RLREDGFLGSTDSSSSGGSRYCSDCSTPRSPPSPSIVGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSVGQDFDELCHAVCTYVKRYNSRKAFYTRFENGDDFAVIRRASVG
FT                   GLHVFVKRGNFTARFPMSASRYEHHYDASMKGAGLSWVRKSRFPNVEVIRRRRSRTGGS
FT                   LASFPDANLRINSDQPSDSVQAVPVSGENSPSSRGASSPRRDPVEGSGWYKLGSPSHHS
FT                   SAARGQRSTERGKIGDFSFPSSTVYNAHVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLQLDSYGFSEDLKDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYGVRGYFSATRLYHCCFTDSPRPFKSLNKYHKMGGEEGALLITDTDRLRAVGSA
FT                   YEKVKGRLPDSLLVRSVEKDLIEFNQTLVDTQRARPGVAVPFQMSENQQVMLTRAYPEF
FT                   NINFTHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPLFHLRAGHTGVHVCRPVY
FT                   DIKDAHRRVVRHHQLSKVAFDHTDGSKQVGAVNTNTVCGNILGECFHASDAIVMVQVYD
FT                   VPLRELCRAMVNKKASVCYMTMVTPGELLDARESFFIKELDCSVELDAVADRVVYCFNN
FT                   SAYTHTYSTICEYMRTPCVVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISEIKRLRY
FT                   RRCDSDLIRIKIPRYSNKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAISEKCRDLFVGIQEAVERYVKSYLRNSFNISFADLSDPLLTISEYSELD
FT                   VPIDLPGFGCMTEGDEAKLIEDGVKSALLRKAVRDEAQLILERGGTSEIVPCGDDDGLG
FT                   SDGSDSLLGSGSDSSSNASSGGLRAGAAPSLFRSLLKKLGGGFCMAKRLLDLLCERLAG
FT                   SLSRLKFGTTHLTSFFSMLRAKLSRNFFDDSIFTAVWDVVMNLIRIVNGVTRTKLECFR
FT                   NVLRLIPTLCSGCKDFAKDFANMCRLVLLFSTEFFSKSYTKLCRFSLEVFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVVLTYPLGSISFPVVCARVFGALAMEVGSNYCFKKTFGKPEI
FT                   LGEDAFRRTVSMVLSAKAFDKLSIDGKGLVRCSGVIPGVLRIVLSSLFSDADAWVGYSK
FT                   HEVSSLPMITYSAKKLSFALEQTKEACIAFIVDSSKRILASLTSEIHESFQNSELTNGA
FT                   KSLYGHVSSVLSASNGVVSKAGNAVAAVKAAGSGLSKRVRRIRPSFRLARCVNEQTSEY
FT                   YSASDESELDESLLSDTPGLRGNGKCNDLFRVVSGRVSVCCRRAVEALKRLVLHVGDCL
FT                   YSRIMDSFVRLFVETNVAVGKCESFAVDCTRKISDLVIGYITWRNLHSGAYSTTPGLSG
FT                   GSRNSLSRFLDGSLTCVIRNIVTAWLTVFDETFCLSLVHRMRTASINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCVFVWNIVKELSICIYGRLPVCVTRLCNRAFRRGS
FT                   NEGDVRTLQVITEAENRIEFLREVLAEMARYRASLEIPVPGSPDSPLFPPTYGEIEELG
FT                   NDSSDSARLIGVDNGSDSVPTESEAELDSDGDSDDSIPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLKFVWRMLRNLFNLRAVKFSYGLALQCIFNGGSMGQFTSRLLFSFGNCLPFELFRHV
FT                   CSVRRLSKSLALRVRNASICDEETVERFFSFSRFLYDSRYLSDVFSVLERVDFYLSYLF
FT                   SLPKRCLTRNRSVRVCTRAPVRVIRDMGLVEDGKKSLTEVLNSLDSLKVSDRKGKSALI
FT                   ESDGSDSESGHSFGSISFGSVNEEVLEAVNGGVVSEKAPLMKHAAALSRLEPDLSGNKD
FT                   LPIVKRSFTRGESSGTKPAGSLCVYLTTLNSSFGSVPDPYPVARNITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDLDDDVNVVDFNLKVIVGRHGTRPFR
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   VKTAGRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSIG
FT                   KSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQ
FT                   GETYKKVRLVRCKYQEDTPFCSDNHVVVALTRHVDSLTYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVVVGSSVVQLGD
FT                   TSEELSSRPFESGCDNITVRDTAPPDSGNLHEPARVRRGKVASNSAKKSVPTRKSSVVR
FT                   KS"
FT   CDS             <9327. .10811
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK30156.1"
FT                   /translation="GTLHPLIQVIYTNRLAFGVVRSQAIPPRKASLQENLLSYESRNYN
FT                   FIKTERFVGPENFGKVMAAAVIERCFRMDEVAKIRSDIIALTEANIQKWLNKRTPCQVK
FT                   SVQAELKLPFAVEEQITNYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPC
FT                   FDEFKNRVLSSLNGNIVFFTEMTNAGLAEVIRRIIGDDDNLFVGEVDFSKFDKSQDLFI
FT                   KEYERALYSEFGFDDELLDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLV
FT                   TLGILSLYYDVSKFELLLISGDDSLIYSKEKISNFSSEICLETGFETKFMSPSVPYFCS
FT                   KFVVQTGNKTCIVPDPYKLLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLK
FT                   LLVETKYGFTSGTTMPALCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLI
FT                   CERVVYDNRVGYFSYFDNPFAKPDASDGQADDLATG"
FT   CDS             10860. .11771
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK30157.1"
FT                   /translation="MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIIVSPPVSGTHKIRAHVDNQPNREGNVTYVKT
FT                   VDKSRFVIRIKAMPASMRGYYSFRAFVSGDVASERSEFICSFVGSRFLCCCTQTISENL
FT                   NNVCSSSFFFRAVSETATNEFSVVTDDVEDIKYVRKRAEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRTDTVGNVAVTVPNTPLVNAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLTIIFI"
FT   CDS             11841. .11996
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK30158.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNASPY
FT                   GTHVTV"
FT   CDS             12002. .13786
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK30159.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGIKSMP
FT                   VPYLSPLNNDLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKRERFLLRTLFDTLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13710. .15320
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK30160.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRSFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLNSLMTGVEDRKVPDELISV
FT                   DPHEVGCRFTLDDVESYLISRGEDSTDVTAVEHSWCLSNSCGKLLSSTEIDAYKTMVFT
FT                   KTFDSGIFGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   TLVPFDPTDFVLDIPKLNIHDTMVVVGNQIRHLEHVVESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAADRVVERPALFNLPQKLLSQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLKFPPISSVRLPAHHGYLYVDFYKRIPDN
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRYMSRD
FT                   VATTGFNLPFHYGRLHDTS"
FT   CDS             15295. .16017
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK30161.1"
FT                   /translation="MAGYTILPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIES
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16109. .16780
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK30162.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16746. .17249
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK30163.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDRLESMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGMFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17283. .17642
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK30164.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGREPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRANVSEIVESHMSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
FT   CDS             17718. .18266
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK30165.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   TMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18348. .18977
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK30166.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSLEADRLEFLRKMNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHDKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18978. .19249
XX
SQ   Sequence 19249 BP; 4737 A; 3797 C; 4906 G; 5809 T; 0 other;

kc517493 Length: 19249  30-APR-2013  Type: N  Check: 8486  ..

       1  aatttctcaa attcacccgt accctccgga aatcacgtcc ggacgctgcg
      51  ggaatcggtg taaatcccgg caaattgccc actacgccca tacaaacaaa
     101  tataatatgt cgaaactcgg agctcgcttc aagtcctcga ctttcgctgt
     151  acgcagcgat tacatcatct cgcgcatctg gcgcgccttt aacaccgttg
     201  gagtcctgca cttcttcggt actgaaacaa ccaccacggt ggttaaggaa
     251  ttttcggctc ctcagccgat agtccctcta cggaaatcct gttttccgtt
     301  ttctgttcgc gctgctgttc gcgcgattaa agctgccgga cgtcccattg
     351  acgctccgcg ctctggatgc ctctgtggcc tccctgttat cgacacatct
     401  ggtgtcgtac gtccccgctc tgtcgcgggc atttggaggt attctctgtg
     451  taaacctccc cttactgccg ccgccaagaa gtccattcgc aaggcgaaga
     501  aagattctgc tttctttctt agccgggctt cttcactctt ctcacgggaa
     551  gtcccctgcg gcacgcgtca tagacttcgt aggcgcgtta tgaaacgagt
     601  agaccccacc atgcacgaga gtccccaaga cgagatcaaa cataagggac
     651  gccgacatgg caagacttct gacctcccgt atatggggga agcggcgttg
     701  gatgatatcc ttcgctggat tgagggggta aatcccccgc cgtcgatggt
     751  cgccattccg gtgcccatct ctttcggcgc cgtgcccaca acggcatggt
     801  gctctcctgc tgacgcggct gttttacggt gtcgtttaga ctaccacgcc
     851  gcagagactt cctttcgtga cgaaaggaag cacgtgagat acgtctataa
     901  tgacgtgtct tctgctgcca accgtcctcg tacggtttct ccccgcaagt
     951  gcgggcgtgt tttccccagc ggttctgcgc tgggtgttga ggtcccgaac
    1001  actagggatc gccataccgc tttcgtgaga tctactcacg ctagcgtttt
    1051  cttctccgac gcggttcgcc gcgttcgcat gttccgtcct gggcggaaca
    1101  atttcttcac tagcgtcgtc agtgggcggc gcgttagtta ctttagaccc
    1151  ggacctaatg gtacggtgtc tgttttaatg tcggacggtg tcaatacggc
    1201  acgtctcgac gttgttgctc ctgcgtacta tgcgtacgct aaagcgttag
    1251  gcgccaaagt gcgctgtttg tgggagtcgt ccgatttgga cgatgctaaa
    1301  atacgtgacg gccagtgcta cgttcgtcac gtgtacgacg tggcccttta
    1351  cttcggaagg cgcgtcgatc tttctgtgcg ccgaactttg ggtttgtttc
    1401  ccacagtggg tgcactaaaa gcttatcttg ttcgcgagta cggtcgcgaa
    1451  tctttgaagg ttccgatgcg cgggacttac acttttggca gtgtatttca
    1501  ttgcctgtcg actaaatctt ttgtcgactt gagatctatt cctaaccatc
    1551  acttggttgg tggtgcgtct gctcacgtgt ttattgggca gattcgtgtt
    1601  gacgttcctg gtggtgtctc taagccatca cgagcagctg ttcgcaggcg
    1651  taataggcgt ttgcgtgaag acgggttttt aggtagtacc gattcgtctt
    1701  cttcaggagg gtcgagatac tgttcggatt gttcaactcc tcgcagtcca
    1751  ccctctccgt cgattgttgg accaactctc ggccggatac caagtataaa
    1801  ccggaagttc cggtttccag caggcactca gttgagtgtt tctatcccta
    1851  aacgcgatga tgatcgcgtg tacgtgtcgg tcggccaaga ctttgatgag
    1901  ttgtgccatg ccgtgtgtac ctacgttaag aggtacaact cgagaaaagc
    1951  attttacacg cggtttgaaa atggtgatga tttcgccgtc attcggcgtg
    2001  cttccgtcgg aggtcttcac gtgttcgtga aacgcggtaa ctttacggct
    2051  cggttcccta tgtcggcttc aaggtatgag catcattatg atgcgagtat
    2101  gaaaggcgcc ggtttgtcat gggtgcggaa gagtcggttt ccgaatgttg
    2151  aagttatacg ccgtcgaagg agtcggacgg gcggttcttt ggctagcttt
    2201  ccggacgcga atttacggat taattctgac caaccgtcgg attctgttca
    2251  ggcagttccg gtgtcgggtg agaattctcc gtcgtctcga ggagcgtctt
    2301  cgccccgacg tgatcctgtt gaagggtcgg gctggtataa gttgggttct
    2351  cctagtcatc actcgagtgc cgctcgtggg caacgttcca ctgaacgtgg
    2401  gaagattggg gatttcagtt ttccgagtag caccgtgtat aatgcacatg
    2451  tagacgagcg tgcttataaa cgtgtcttga aattgcggga cacgtcggcg
    2501  tcctcttttc ttcgtatagt tttggctcgt ttgtcgagtt atcggcctct
    2551  tagtgacgag ttctttaaca agtgcgttac ttctcggttc gtggcttgta
    2601  tcgaggcggt tgaatcgggt ctcgttacag tacactttcg atccgacgtg
    2651  tttcgcgcct cgttcccgtt tggcgtttat ttgtatactc gtcacgcatt
    2701  tgatatttac agtggtaagc tcctgcaact agatagctac gggttttcgg
    2751  aagacctgaa ggacggttac tgctatattc gtcatattgc tgaggtctgt
    2801  ttgagtatgg gaaaagtttt cttcaggagg gacgttaact taggggcgtt
    2851  cccttatgtt ttcgaggtac agcaccgtct tgagcggttg tacggtaagc
    2901  gcgctgttga atacggcgtt agaggatatt tttcagcaac gcgtctttat
    2951  cactgttgct ttaccgattc accgagaccc ttcaaatctt taaataagta
    3001  tcataagatg ggtggtgaag aaggtgcgtt actaatcact gacactgata
    3051  gattacgtgc cgtggggagt gcttacgaaa aggtgaaggg gcgtttgcct
    3101  gattctttac tcgttcgatc ggtggagaaa gatttgatag aattcaatca
    3151  aactctggtt gatacgcaac gggctagacc cggtgttgca gtaccttttc
    3201  agatgagtga gaaccaacag gtgatgctca ctagagctta tcctgagttt
    3251  aatataaact ttactcattc cgtacactcc gatcaccccg tggctgcggg
    3301  ttctagaatg ttagagaatc accttgttcg taaatacgca ggtagcgatt
    3351  attcggacgt aggtggttgc ccattatttc atttacgtgc gggtcataca
    3401  ggagttcacg tttgcagacc agtgtacgat attaaagacg cccaccgtag
    3451  agtcgttcgt catcatcaac ttagtaaagt agcttttgat cacactgacg
    3501  ggtctaagca ggttggtgct gtcaatacga acaccgtgtg tggtaacatt
    3551  ttaggggagt gttttcatgc gtctgatgcg attgttatgg tgcaagttta
    3601  tgacgtgcca ttgcgagagt tgtgtagagc tatggtgaac aagaaagctt
    3651  cggtgtgtta tatgaccatg gttacgcctg gtgagctgtt ggacgcccgt
    3701  gagtccttct tcatcaaaga gttagactgt tcggtggagt tggacgctgt
    3751  cgccgatagg gttgtctact gttttaacaa ttcagcgtat acgcatacct
    3801  attctacgat atgcgaatac atgcgtactc cttgtgtggt ggtggatggt
    3851  tttctgttca ctatagagat ggtttcgctc agatgcagcg ttaactatta
    3901  ttgtatcacc aaatcgcggg tttgtccgag aatcagcgag attaaacggt
    3951  tacgctatcg tcggtgtgat agtgacttga tcaggatcaa gattcctcgg
    4001  tactctaata agactcgtag ttgtttacca gggtgttatt atttgtattt
    4051  agacgctaag ttcgtgagtc gtgtgtacga atacgtggtt aataattgtg
    4101  ttgtggtgaa tgctaagact tttgaatgga cttggaacta catcaagtcc
    4151  tgtaagtcga gagtggtcat cagtgggaag atcatccata gggacgttcc
    4201  tattgcgttg gagtatttgg atgggttttc cgcagttatg ttgtccgcgg
    4251  gcgtgaaagg taggcagaac gcggaagcgt tttctaggcg tctagcggcc
    4301  ttttcaggcg acacttctct tttcgaattg gtgaggttcg ccatttcaga
    4351  gaagtgtcgc gatttatttg tgggcattca ggaggccgta gagagatacg
    4401  tgaaatcgta cctcagaaac tcgtttaata taagtttcgc ggacttgtca
    4451  gatccattgc ttaccattag tgagtattcg gagttagacg ttcctatcga
    4501  tttaccgggt tttggctgca tgacggaagg agatgaggct aaactcatag
    4551  aagatggggt taagtcggct ttactgcgaa aagcagttcg tgacgaggcg
    4601  caactcattc tcgaaagggg cggtacgtca gagatcgttc cttgtgggga
    4651  tgatgatggt ttaggcagcg acggttctga cagtttactc gggtccggaa
    4701  gtgattcgtc ttctaatgcc agttctggtg gtttgcgggc cggggccgcc
    4751  ccttcactgt tcagaagctt gttgaagaag ttgggtgggg gtttttgtat
    4801  ggccaagagg ttattggact tgttgtgcga gcgattagct ggttcgttgt
    4851  cgcgcttaaa gttcggtacc actcatttaa cctcattctt tagcatgtta
    4901  cgcgctaagc tttcgcgtaa tttcttcgac gactcgattt ttaccgctgt
    4951  ttgggacgtg gtgatgaatt tgattagaat cgtcaacggg gtgaccagga
    5001  cgaaattgga gtgttttcgc aacgttcttc ggttaattcc tacgttgtgt
    5051  tctggttgta aagacttcgc aaaagacttt gcgaacatgt gtaggttagt
    5101  tttgctattt tctacggagt tcttcagtaa aagctatact aaactgtgtc
    5151  ggtttagttt ggaagtattc gatgtcggac tcattgagat ttcagcgcgt
    5201  aacatgggac tagagacttg tgtttcgatg gcttcagcta tttttgacgt
    5251  cgtacttacc tatcctctgg gaagtattag ctttcccgtc gtatgcgcga
    5301  gagtttttgg cgccctcgct atggaagtgg gatcaaacta ttgttttaag
    5351  aaaactttcg gcaaacctga aattttagga gaggacgctt ttcgtagaac
    5401  ggtaagtatg gtgttgagcg ctaaggcttt cgacaaactg tcgatcgacg
    5451  gtaagggttt agttaggtgt tccggtgtta ttcctggagt tttgaggata
    5501  gtgctttcgt ctctgttttc cgatgctgac gcgtgggtgg gttatagcaa
    5551  acacgaagtt tcctcacttc ccatgatcac gtatagcgcg aaaaagttat
    5601  ctttcgcgtt ggagcagact aaggaagcgt gcatcgcctt tatagtcgat
    5651  tcgtctaaga ggatcttagc gtctttgacc tcggagattc acgagtcttt
    5701  tcaaaattcg gaactaacta atggtgctaa gtccttgtat ggacatgtga
    5751  gttctgtact ctcagcgtct aatggtgtgg ttagcaaggc aggaaacgcc
    5801  gttgcagcag ttaaagcggc ggggagtgga cttagtaaac gtgtgaggcg
    5851  cattcgtcct tcttttcgcc tagctcggtg tgttaatgaa cagaccagcg
    5901  aatactattc tgctagtgac gaatctgagt tggacgagtc gttgcttagt
    5951  gacacgcccg gtcttcgtgg taacgggaag tgtaacgatt tgtttcgtgt
    6001  cgtttccgga cgtgtttcgg tatgttgtag gcgcgctgta gaagctttga
    6051  agcgtttagt cctacacgtc ggtgactgct tgtactcgcg cattatggac
    6101  tcttttgtga ggttatttgt tgaaaccaat gttgcagtcg ggaagtgtga
    6151  atctttcgcc gtcgactgta cccgaaaaat ttctgattta gtaatcgggt
    6201  atattacttg gcgcaatctt cattccggtg cgtactcgac gactccaggg
    6251  ttatctggtg gtagtaggaa ttctctttcc aggttcttgg atggtagtct
    6301  cacgtgtgta attcgaaata ttgttaccgc gtggttgacg gttttcgatg
    6351  agaccttttg tttgagtcta gtccatcgga tgaggactgc ctcgataaat
    6401  gtgttgttag aattcttgaa gaacctccca gtttgtttag tttcgatata
    6451  cactttcata gagtgtagat ctaggatttt ccctttgaag gaatttcttt
    6501  ggggcttttg cgtttttgtt tggaacattg ttaaggaact ttctatatgc
    6551  atttacggac gtctccccgt ttgcgttacg aggttgtgta atagggcgtt
    6601  ccgtcgcggt tccaacgaag gtgacgtgcg tacgcttcaa gtgatcaccg
    6651  aagccgaaaa ccgaatcgag tttttgcgag aagttctcgc cgaaatggca
    6701  cggtatcgtg cttctctcga gatacccgta ccggggtcgc ctgatagtcc
    6751  tttgtttcca ccaacatacg gtgagattga ggagttaggt aacgattcct
    6801  ctgacagtgc ccgattgata ggtgtggaca atggttcaga ttcagtgccc
    6851  actgaaagcg aagcggaact agattcggat ggtgatagcg atgactcaat
    6901  acctttggat cgcgactttg agcaaatcgg aggtcttggc ggaagcggta
    6951  acgttgacgt ctttcgttta gggctgaagt tcgtgtggag aatgttgcgt
    7001  aatctgttta acttaagagc cgttaaattc tcctatgggt tagctcttca
    7051  gtgtatattt aacggcggtt caatgggcca atttacgtcg cgactgttat
    7101  tcagtttcgg caattgctta ccgtttgagc tctttagaca cgtttgtagt
    7151  gtgaggcggc tgtcaaagag cttagcacta cgtgttcgca acgctagtat
    7201  ttgtgacgaa gaaacggtcg aacgtttctt cagtttttcg cgatttttgt
    7251  acgattcgcg ttacttatcg gacgtgtttt cggtgttgga gagggtcgat
    7301  ttctacttaa gttatctatt ctcgttgccg aagaggtgtc ttacgcgtaa
    7351  ccgtagtgtc cgagtttgca ctagagctcc agttcgcgtg attagggaca
    7401  tgggacttgt agaagacggc aagaagtctt taaccgaagt gttgaactct
    7451  ttggactcat tgaaagtgtc cgaccgtaaa gggaagtcag cacttattga
    7501  aagtgatggt tccgactccg agagcggtca ttcgttcggt tccatttcat
    7551  tcggatcggt taatgaggaa gttttagaag cagtgaacgg tggtgtcgta
    7601  tccgaaaaag ctccactgat gaagcatgcg gctgcactaa gcaggttgga
    7651  gccagacctt agtggtaata aggatcttcc tattgtcaag agaagtttta
    7701  cccgcggtga atcttcaggt acgaaaccgg caggaagctt gtgcgtgtac
    7751  ttaacgacgt tgaattcttc gttcggttcg gtgcctgacc cgtatcccgt
    7801  cgcacgtaac ataacgtaca agaagatgac caacgccatg cgcgagtttt
    7851  attactcgca aaaggtaacg ttgtacgaac ttcatggaaa attgagctcg
    7901  tactgggatg aattaaagac ggtaggtttt gataggaagt tggcgaagat
    7951  ggatttggac gatgacgtta atgtcgtcga ttttaacttg aaggtaatag
    8001  tggggaggca tggtacccgt cctttcagaa atactgtgaa ctctcacgag
    8051  ttcatgtttt gtgacgacgg attggtgctt tgcccgggac cgaaaaaacg
    8101  tgactttgct ctgatctcta gtcaaacaca attcgttgct gcgaactcat
    8151  tcctgcgtgc cgtggacggt aaagatttga cgttcactaa ttcggagcat
    8201  agtctcatag tttatgaggc tcctcccggt ggtggaaaga cgcattcttt
    8251  ggttacgtat ttcgccgatt attgtaccaa agtgtcttgc ttggtggtga
    8301  ccgctaacaa aaattcgcaa gcggagattt ctcaaagaat ctctagagag
    8351  ttaatggata gaaagatgct tgctaaacac gttgttaaaa ccgccggtag
    8401  agtgttcact gtggactctt atctgatgaa ccatattcga ctcaagactg
    8451  atttgttgtt tgtcgatgag tgttttatgg ttcatgctgg agcaatcgga
    8501  gcggttgttg agttcacttc atgtaaggct gtggttttct tcggtgatag
    8551  tagacaaatt cattatattc accggaacga ttttggtgtt tcattgttgc
    8601  atgacataga cgcatttata gaaccacagc accgcattta cggtgaggtg
    8651  tcctacaggt gtccttggga catctgtgag tggttgtcta aattctatcc
    8701  gagacatgtg gccactgcta acactggtag tatcgggaaa tcgagtgtgt
    8751  ctatagagat aattaatggg tgtgacgatg ttccttacga tagtagcgcg
    8801  aagtacatcg tttacacaca agcagaaaag aacgaactgc aaaagcacct
    8851  tggtcgttta accgtaggcc gaactaaagc ggtgcctatt gtgaacacag
    8901  tgcatgaagt tcaaggtgaa acatataaga aggtccgttt ggtaaggtgc
    8951  aaataccaag aggacactcc tttctgttca gataatcatg ttgttgtggc
    9001  tttaaccagg cacgtcgact ccttaactta ctccgttttg aatagcagga
    9051  gatacgacaa gaccgcttcc agtatagatg aagcgaggga gatttttgac
    9101  aaatttcgtt cgacgaacca ttctcacggt tcttcgacgt tggaatggta
    9151  ccttgagaaa taccctactg aatataaggg tagtaaagca tcttcggcgc
    9201  cgttaagttg tattaacgag tttcttaacg aggtcgttgt cggttcttca
    9251  gttgtgcagt tgggagatac ttcagaagaa ttaagttctc gtccttttga
    9301  gtctggatgt gacaatatta ccgtaaggga cactgcaccc cctgattcag
    9351  gtaatctaca cgaaccggct cgcgttcggc gtggtaaggt cgcaagcaat
    9401  tccgccaaga aaagcgtccc tacaagaaaa tcttctgtcg tacgaaagtc
    9451  gtaattacaa ctttataaag acggagcgat ttgtggggcc cgaaaatttc
    9501  ggcaaagtca tggctgcggc tgttattgag aggtgtttta ggatggacga
    9551  agtggccaag ataagaagtg atattattgc tttgactgaa gccaatattc
    9601  aaaagtggct caataaacgt actccgtgtc aggtaaaatc tgtgcaggcc
    9651  gaattgaagt taccgtttgc tgtggaagag caaatcacca actacaaact
    9701  aatggttaag cgtgatgcca aagtaaagct cgatgattcg agtctgtcca
    9751  agcaccctgc cgcacagaat attatgtttc ataagaagtt tattaatgct
    9801  atttattctc catgcttcga cgaatttaag aatagggtgt tatcgtcact
    9851  aaacggcaat atagtgttct ttaccgaaat gacgaacgct gggttggcgg
    9901  aagtcattag aaggattata ggtgatgacg ataatctttt tgttggggaa
    9951  gtggatttca gtaagttcga taagtctcaa gatttgttta ttaaggagta
   10001  cgagcgtgcg ttatactctg agttcggatt tgatgacgaa cttctcgacg
   10051  tgtggatgga aggcgagtac cgcgctaggg ctaccacgtt agacggtcag
   10101  ctgagttttt cggtcgatgg tcaacgtcgt tcgggaggtt cgaacacatg
   10151  gattgggaac tctttggtta ccctgggtat cctatccttg tattatgacg
   10201  tctcaaagtt cgagctactg cttatatctg gtgacgactc tctgatctat
   10251  tcaaaagaaa agattagtaa cttttcttca gaaatttgtc tggagacagg
   10301  ttttgaaact aagtttatgt ctcctagcgt accatacttt tgttcgaagt
   10351  ttgtggttca gacagggaac aaaacgtgta ttgtaccgga cccttacaag
   10401  ttgttggtta aactgggggc tccccaatac aaattgactg atgacgaact
   10451  cttcgaactg ttcacttcct ttaaagacat cactcaggac tttggtgatc
   10501  aggtggtcct agagaagttg aagttgttag tagagactaa gtacggcttt
   10551  actagcggaa ctactatgcc cgctctatgt gctatacatt gtgtacggtc
   10601  taattatttg tcttttgaaa ggttgtttcc ctttattaga ggttggtatg
   10651  ttgtcgacgc tttgaagctt agacaactga ggaaattcgc caatttgatc
   10701  tgtgaacgtg tggtttacga taatcgcgtg ggttattttt cgtactttga
   10751  caatccgttt gctaaacccg acgctagcga tggtcaagcg gatgacttag
   10801  cgacaggctg atagtttgtt cagttctcgc tgagagctaa cacaggtagt
   10851  tgagtcgaga tgtttgcctt cgcgagcgaa aaccaagaca tattagaaga
   10901  aaagattttt cgccgtagaa cctgccatcg taagtattta gatgacgtgg
   10951  ttagggactt taccattgat attggttatg atactgtcga tcgtgatcct
   11001  acggtattgg ctgattattt ctcgttgtat ttctttttgc ttaacaatga
   11051  taacattggg cctttagcag cttcgattat agtaagccca ccagtaagcg
   11101  ggactcataa aattcgagcg cacgtcgata atcaaccgaa tcgtgaagga
   11151  aacgttactt acgttaagac tgtcgataag agtcgttttg tgattcgcat
   11201  aaaagcgatg ccagcttcta tgagaggcta ctactccttt cgggcgtttg
   11251  ttagtggtga cgtcgctagc gaacgtagcg agtttatatg cagttttgtt
   11301  ggtagtaggt ttctttgttg ttgcacacaa acaatatccg aaaatttgaa
   11351  caatgtttgt tcgtcttcct tcttctttag agctgtttcg gaaactgcta
   11401  ctaatgagtt ttctgttgtg actgatgatg tagaagacat taagtacgta
   11451  agaaagcgag ccgagggttt ctcacattgc gctgacccgt atccacctag
   11501  gtgttatcgt aacgctaatt taggtgatag ttcaggggtc caaagtcgca
   11551  cgattgaaga ggaaggttat aggacggaca ctgtgggtaa cgtcgcggtt
   11601  accgttccga acactccact cgttaatgcc gtctctccgt atgtcgccga
   11651  gtacaacgaa aatacacgtt cgcgtatctc gttaatacgg cgagtctgct
   11701  gttacgccgt ctgtgtttta gtggtttctc ttcttataat gagcggtttg
   11751  ttgactatca tattcatatg acttggtgta gtaacttatg gggcatggtt
   11801  agctaaaact caccgtttga ctctgtttaa acggggttca atggactgtg
   11851  taattcaagg gtttttgact tttctagttg gtatagctgt gttttcggct
   11901  tttgccggac taattatcat tgttataacg atttatcggt gcacgactaa
   11951  gcccgttaga aacgcctctc cttacggcac tcacgtcact gtttaagcgg
   12001  tatggtgctt ctgggtttag actttggtac cacgttttcg acggtggcta
   12051  tggctacatc ttctgagtta gtaatactta aacaatccaa ttcgtcgtac
   12101  atacctacgt gtttgtttct gcatgcagat cctaacagcg tgtcttatgg
   12151  ttacgatgcg gagtacttag cggcttcggg ggaacctggc tcgttttaca
   12201  aagatttgaa acggtgggtc ggttgtactg agaagaacta ccaaagttat
   12251  ttgcacaagt tatcaccttc ctataaggtg atagtaaaag agttcggaat
   12301  taagagtatg ccggttccgt atttgtcacc tcttaataat gatcttgggc
   12351  tcagtgtcgc tttgccttct ttgatcgctt catatgccaa atcgatttta
   12401  tcggatgcgg agagagtgtt caacgtgagt tgcactggag ttatatgttc
   12451  ggtacctgct ggttataaca cgttacaacg agcttttaca caacaaagtg
   12501  tgtccttgtc gggttattct tgcgtgtaca ttattaatga accttccgct
   12551  gctgcttact ccactttacc taagttgagt tcggcggata agtacttggc
   12601  cgtttacgac ttcggcggtg ggacctttga tgtttctata gttagtgtta
   12651  ggttacccac gttcgccgtt agaagttcgg gtggtgatat gaacttaggc
   12701  ggtagagaca tcgatagaaa gttatctgat aaaatatatg agttggctga
   12751  ttttttaccg caaaaagaac tgaacgtttc cagtttaaag gaagctttat
   12801  ctcttcaaac agatccagtc aagtatactg taactcatta cggaatgagt
   12851  gaaaccgtat caatcgatca aacgacgttg agggagatag cttcggtatt
   12901  tataactcga acgatagaca tacttacaca agttaaagct aagtccagta
   12951  tgcccgagtc gcaaagtttg aagctagtgg tagtcggtgg aagctcgtac
   13001  ctaccagggt tgttggatac tttggaaact gtaccttttg tgtctgggat
   13051  agtaccagtg gaagacgcaa gaaccgccgt tgctagaggg tgcgctttat
   13101  atagcgagtg tttggatggt aggtccaagg ccttactaat agattgcatt
   13151  acgcatcatt tgtcggttac gacatttagc gcagactcgg ttgttgttgc
   13201  tgcggccggt agtccaattc cttttgaagg agaacgcaaa ctcacgttgc
   13251  gtaagtgtgt tagtacatcg aattatcaag caaggatgtt cgaaggagat
   13301  tacgaaaagg ttttccgaaa cgaacgtata tacgcagctt cggtgtcatt
   13351  gtttactttg ggagttaact ggcgcgtgcc taacgacgtt gagatgactc
   13401  tcgtgaccaa agtggactca atgggtaaag tggaattcta ccttaaaggt
   13451  ccatctggtg aattagttaa cgtgcaaggt acttcacatt atgattatgt
   13501  tggtatgcct catcccacta gaaagttgtt gaggcttagc gattacaatg
   13551  taaactccgc cgctttagtt ttagctttga cattgactcg cgaaaaacga
   13601  gaaaggtttc ttttgcgaac tttatttgat actttactag cagacttgcg
   13651  aaagaccgca agtttaagcg aatattctaa gaaatatccg attactcgaa
   13701  acgacatcga tgtcgtctca tcacgtatgg ggatcgttgt ttcgaaagtt
   13751  ttacggggaa gcgatttgga aagagtacct ctctgaatca actcgaagtt
   13801  tcgacgagag aaacgtatcg ttagaccaca ctctaagttc gggtgtggtc
   13851  gtccgtaggc aaagtctttt gaacgcgcct caagggactt tcgagaatga
   13901  gttagcgcta ttatacaatt cggtggtaat caacgatttt gttgaattga
   13951  ctggtatgcc gttgaattct ttgatgacag gtgttgagga ccgtaaggta
   14001  cctgacgagt taatatccgt tgacccgcat gaagttgggt gtagattcac
   14051  gttggatgat gtagagtcat atttaataag caggggcgag gattccactg
   14101  atgtaacagc ggttgagcac tcgtggtgtt tgagcaattc ttgtggtaaa
   14151  ttgttaagtt cgaccgaaat agatgcttac aaaaccatgg tgtttactaa
   14201  gacttttgat agtggtatat tcggggtgac cactaaatta gagacgtatc
   14251  tatcgtattg catatcgttg tacaagaaac attgtatgaa agacgatgac
   14301  tactttaacc ttatattacc tatgtttaat tgtttgatga aagtgctggc
   14351  gtcgcttggt ttgttttacg aaaaacatac tgacaatccg ctgctgaccg
   14401  gcatgctcat agagttttgc ctagagaata aggtgtatta ctctactttt
   14451  aaagtaaatt tggacaacgt taggctgttt aagtctaaag tgttgcctgt
   14501  ggtgttaacg gtctgggata tatctgagcc tgatgacccg gtggatgaga
   14551  gaacgctagt tcctttcgac cctacggatt tcgtgcttga catacccaaa
   14601  ctgaatatac acgacactat ggtggtggtg ggtaatcaaa tcagacactt
   14651  agagcacgtg gttgagagcg atgcattaga cgacttgtct caacacgttg
   14701  acttgaattt agcagcggac aatcccgatc tacgtgttga tttgcgttgg
   14751  gcagggatgt ttgtgtatta cggcatatat cggtgcgctg cagatagagt
   14801  ggtggaacga ccggcattat ttaatctacc gcagaagttg ttgagtcaag
   14851  acgacggtga atcatgcttg ttgcgtatga gttccgttga aaccttattc
   14901  aatctggtgc agaaggtgaa taaggacata aatattaggc gtcaattcat
   14951  gggacgtcat agtaaagtgg ctttgcggtt gtatcgcaat ttaggtttga
   15001  agtttcctcc aatttcctca gttaggttac cagctcatca cggttactta
   15051  tacgtcgatt tttacaaaag aatacctgat aatgctgttg acgccgacga
   15101  acttgaaagt ttacgtcaat tacgttcgtc cgtagacgtt atgtgtaagg
   15151  acagagtgtc aatcacgcct ccaccgttta atcgacatag aaggggttct
   15201  tctagaatac ttagaggtcg aggcgcacgc ggtgcgagct cgcgttatat
   15251  gagcagagac gtggcaacta ccggttttaa tttacccttt cattatggca
   15301  ggttacacga tacttcctaa aactgatgac aaagaaatgg atccggtgag
   15351  tgccgctgtg cccggtaaat acccggacgt tatcgaaaaa tttgtgacca
   15401  ataggtcagt ggatgcgtta atagaaagcg ttattagcaa gttggatact
   15451  aattcaatat acgaagattc cactgaaaaa tttactggtg agcaactgaa
   15501  gtacgtcatg gttactatgg acactttctt actagaaaat tacaaaacga
   15551  aaacggaaga tctgctggtt cacttggcta tgattcaaaa gaggttgtgc
   15601  actatatcta cgagtactaa aaccaagttt cgtgataaag gttgtatcag
   15651  ttatgtacaa gggggtttac gatataagtt aatggataag gtagtttttc
   15701  cttttattat atctaagttc actgacaggg agactccaaa cgctctacgt
   15751  aagtatgctt gtacttttga ggagttacac ttgtgcatgg ctaggttgag
   15801  acccgacttg tacgaaaaca aaaggacgac caaagctggg actccgcatt
   15851  taaagggcta cttatcagct gactttctta cgggttccct cccaggatat
   15901  tccgaacatg aacggggtat cattcttcga gcgtcagaat ctatgttagc
   15951  tagacgtcaa ggttatgagg aagcaaccga gcttcttaac ttacgcgatt
   16001  tgggaaagta tttgtagttt gtttgcggac ggtggtatta cgccatccca
   16051  tgagcactgc tttaagggtc gttaattgac gactcttgat atttactaag
   16101  tttgagttat ggacgacgaa acaaagaaat tgaagaacaa aaacaaggaa
   16151  acgaaagaag gcgacaatgt tgttgcagcg gagtcttctt tcggttctgt
   16201  aaacttacac atcgatccga ctctgatagc gatgaacgat gtgcgtcagt
   16251  tgggtaccca acagaatgcc gctttgaaca gagatttgtt tcttactttg
   16301  aaagggaagt atcctaattt gtctgataaa gataaggact ttcacttagc
   16351  tatgatgttg tatcgtttag cggttaagag ttcatcattg caaagtgatg
   16401  acgacactac gggtataacg tacactcggg agggcgtcga agtggatttg
   16451  tctgacaaac tttggactga cgttgtgttt aattctaagg gtatcggtaa
   16501  ccgtactaac gcccttcgag tctggggtag gactaacgat gccctttatt
   16551  tagccttttg tagacagaat cgcaatttga gttatggcgg acgtccgcta
   16601  gatgcaggga ttccggccgg gtatcattac ctgtgtgcag atttcttgac
   16651  cggagctggc ttgactgatt tagaatgtgc tgtgtacata caagctaaag
   16701  aacaattgtt gaagaagcga ggggctgatg aagtcgtagt taccaatgtc
   16751  aggcagcttg ggaaatttaa cacacgttga tctattgcgt tctgattctc
   16801  ggtttctatc gggatggtgg agtttcatcg tgaacgtggg tgatataatc
   16851  gttcggtttg cgttacacgt tcctagtgaa gatgtgctga atagcttttc
   16901  agctatatcg aattgtacga tcatagcgga cggtagtgct ttactaaaag
   16951  acaacactgt ggttgaccgt ttagagagca tgaacccctt ggcttatttg
   17001  ttaaaattag cgaaaacgac tactactatt tgttttacta tgtctaataa
   17051  ggttcttttt ggtactacta aatccgaacc gcttagttgt ttagctatca
   17101  cgtcggaccg agttttattc aaagttatta tgggtactaa cgttgatgat
   17151  tctcgatgtg gctgcagtat ttggttttac aacaatggga tgtttcaaaa
   17201  tgggttgacc cgttgtaata atctcgtcgc tttgtttagc gcgacttaga
   17251  cacgaagtga ccgttcgggt ttaattgctg caatgagtat tcgacgtgtg
   17301  tggttaaagg taatggctgt aattacggta ttgtggtatg gtagagaacc
   17351  ttccattagc gaaggttaca acgctcttat gaatgatgac tttaagttta
   17401  tcgatacgca tttttcaaac gtctcttatg ctaagaaatg ttacgaattg
   17451  gctaatttcg atttagactt tctacgcatc gttatcattc ccctaagtgg
   17501  tggtgcggtg aatgaatcgc gtgctgatcg cgctaacgtt tctgagattg
   17551  tcgaatcgca tatgagcgat cgagatagaa tgaatatctt gttgcgtaat
   17601  aagcggatcc agattccttc gctcttacct tgcgataact agagtctact
   17651  cagtagtacg tctactagta taacgtattg aacactttag tgaggagttt
   17701  tgtttaaacc aaacaatatg cgagcttact ttagtgttaa cgattacata
   17751  agccttttgg ctaaagtcgg cgcagttgtg gaacgtttat gcgatccaag
   17801  cgtaactctc acggaagtga tggacgaaat taatgatttt aactcgtttc
   17851  tcgctttggt acactctatg aagtcggaca tgaacggcga tcatcaggat
   17901  ggtcaccatg agatgggtga acacaagtct cgattgttgt gcaatataga
   17951  ggcgaaactg cgaatacttc tcgacatcat aagacgtcgg tttactcgtg
   18001  acaagctact ctgtaccagc gcaacagata ccatgggctt cttcgttatg
   18051  aggtacatga gttctagtca caccagtttc gagtccgtaa tgcgaacgga
   18101  gctgaaatta gtggttaaag cggtactgtc ggatttatcc cgcgcgcata
   18151  aactagattt tagcgagcga gcctttgctg cttacggtat ccttttacaa
   18201  aagggtactg tagcgacagt ttgcggtcag tttgacatta atttagtttc
   18251  tccatcttgc gtgtaggtta atacgtttct cagaacgtgt ggttgtatta
   18301  actaacttta attcgaacga attattgtta agaatctgcg agttacgatg
   18351  gacgatacta gcggacaaac tttcatttct gtgaaccttt ctgacgaaag
   18401  caacacagct agcactgaag tcaaaaccgt aagtttagaa gctgatcgct
   18451  tggaattttt acggaaaatg aatcccttta ttatcgacgc cttgatacgg
   18501  aaaaccagtt atcagggtgc tcgctttcgc gcgagaataa taggagtgtg
   18551  cgtggattgt ggtagaaaac acgataaggg atcgaggact gaacgtaagt
   18601  gtaaagtcaa caacacacaa tctcagaacg aggtggcgca tatgttaatg
   18651  cacgatcccg tgaaatattt aaataaaaga aaagctagag ctttttctaa
   18701  cgcagagatg tttgcgatcg atttggttat gcataccaaa gaaaggcaat
   18751  tagcggttga tttggccgct gaaagggaga agacgagatt ggctcgtaga
   18801  cacccgatgc gttctccgga ggaaactccg gaacattata agttcggtat
   18851  gactgctaag gcaatgttac cggacatcaa cgctatagac gttggtgata
   18901  acgaggacac ttcgtcggaa tacccagtga gtctgagtgt ttcaggcgga
   18951  gttctccgtg aacaccactt catctgattg aagtggacgg aataagttcc
   19001  ttgcggaact ttatgtcggg ttggtaaaaa cccttatgat ggtgatgtat
   19051  cactagacaa taaccggatg ggtaaagtct ttaaaatgat cgaggggaaa
   19101  attaaccata tcctctcgtt ggtctaagct cccacagagt ggtagtggtc
   19151  tcaagtgagg cttaacgtat gcgtgaacca aagaagttct ccttagagtg
   19201  tgtgttgttt accaacacac tgtccctatg gggggccaac ataggtcca