Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate T3, complete genome.

ACC No: KC525952

Dated: 2013-05-01 | Length: 19253 | CRC: 1472388075

                
ID   KC525952; SV 1; linear; genomic RNA; STD; VRL; 19253 BP.
XX
AC   KC525952;
XX
DT   01-MAY-2013 (Rel. 116, Created)
DT   01-MAY-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate T3, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19253
RA   Hilf M.E., Harper S.J.;
RT   "Citrus tristeza virus: Evolution of complex and varied genotypic groups";
RL   Unpublished.
XX
RN   [2]
RP   1-19253
RA   Hilf M.E., Harper S.J.;
RT   ;
RL   Submitted (24-JAN-2013) to the INSDC.
RL   CREC-IFAS, University of Florida, 700 Experiment Station Road, Lake Alfred,
RL   FL 33850, USA
XX
CC   ##Assembly-Data-START##
CC   Assembly Method       :: Bioedit v. 5.0.9
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19253
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus macrophylla"
FT                   /isolate="T3"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="12-Mar-2005"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9455
FT                   /codon_start=1
FT                   /product="ORF1a"
FT                   /protein_id="AGK38322.1"
FT                   /translation="MSKLGASFESSTFAVRSDYVISRIWRAFNAVGVLHFFGTETTTTV
FT                   VKEFSAAGPIVPLRKSCFPFSVRAAVRAIKAAGRPIDAPRSGCLCGLPVVDTSGVVRPR
FT                   SVAGVWRFSLSKPPLSAAAKKSIRKAKKDSAFFLSRASSLFSREVPCGTRHRLRRRVEK
FT                   RVDPTMDESPQDEIKLKGRRHGRRSDLPYMGEAALDDILRWIEGVNPPPSMVAIPVPIS
FT                   FGTLPTTAWCSEADAKVLRCRLAYHAAETSFRNEGKHVRYVYNDVSSAANRPRTVSPRK
FT                   CGRVFPSGSALGVEVPSVRDRHTAFVRSAHASVFFSDAVRRVRMFRPGRNNFFTSVVSG
FT                   RRVCYFRPGPNGTVSILMSDGVNTARLDVVAPAYYEYAKALGAKVRCLWESSDLDDAKV
FT                   RDGQCYVRHVYDVALYFGRRVDLSVRRALGMFPTVGALKTYLVREYGRESLKVPMRGTY
FT                   TFGSVFHCLSTKSFVDLRSIPNHHLVGGASAHVFVGQIRLDVAGSISKPSRSAVRRRNR
FT                   RLRKDGFLGSSDSSSSGESRYCSDCSTPRSSPSPSVIGPTLGRIPSINRKFRFPAGTQL
FT                   SVSIPKRDDDRVYVSHGQDFDELCHAVCTYVKRYNSRKVFYTRFENGEDFAVIRRASVG
FT                   GLHVFVKRGNFTARFPVSASRYEHHYDASMKGTGLSWVRKSRFPNVEVIRRRRSRASNS
FT                   SANLPDTNLRVNSDQPSESIQTVPVLNENSSPFRGVSSPQRDPAEGSGWCKVGSPSRRS
FT                   NTARGQRSTERRKIGDFSFPSGTTYNVRVDERAYKRVLKLRDTSASSFLRIVLARLSSY
FT                   RPLSDEFFNKCVTSRFVACIEAVESGLVTVHFRSDVFRASFPFGVYLYTRHAFDIYSGK
FT                   LLQLDTYGFSEDLRDGYCYIRHIAEVCLSMGKVFFRRDVNLGAFPYVFEVQHRLERLYG
FT                   KRAVEYSVRGYFSAPRLYHCCFTDSPKPFRSLNKYHKMGGEEGALLITDTDRLRAVGSA
FT                   YEKVKGRLPDSLLVRSVEKDLIEFNQTLVDMQRARPGVVVPFQMSENQQVMLTRAYPEF
FT                   NINFIHSVHSDHPVAAGSRMLENHLVRKYAGSDYSDVGGCPSFHLRAGHAGVHVCRPVY
FT                   DVKDAHRKVIRHHQLSKVALDHTDGFKQVGAVNTNTVCGNVLGECFHASEAIVMVQVYD
FT                   VPLRELCRAMVNKKASVCYMTMVTPGELLDARESFFIKDLDCSVELDVIADRVVYCFNN
FT                   SAYTHTYSTIREYMRTPCTVVDGFLFTIEMVSLRCSVNYYCITKSRVCPRISETKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCCYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGD
FT                   TSLFELVRFAISEKCRDLFVGIQEAVEKCVRSYLRNSFNMNFVDLSDPLLTISEYSELD
FT                   VPIDLPGFGCITEEDEAKLIEDGVKSALLRKAVRDEAQLILDRGSTSEIVPCGDDDGSD
FT                   GDGSDDLLGSGSDSSSKASSGGLRAGAAPSLFRSLLKKLGGGFCVAKRLLDLLCERLVG
FT                   SLSRLKFGTTHLTSIFSTLRIKLSCNFSDDSIFTAVWDAVMNLIRIVNGATKTKLESFR
FT                   NILRLIPKLCFDCKTFVKDFADMCRSVMLFSTEFFSKSYTKLCRFGLEMFDVGLIEISA
FT                   RNMGLETCVSMASAIFDVMLTYPLGSISFPIVCARVFGALAMEVGSNYCFKKTFGKPEV
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDGKGLVRCSGVIPGVLRIVFSSLFSDADTWVGYSK
FT                   HEVSSLPIITYSAKRLSFVLEQTKEACIAFIIDSSKRILASLTSEIHESFRDSELTSGA
FT                   KSLYGHVSSILSVSSGVVNKAGNAVAAVKAAGSGLSKRVKRIRPSFRLARCVNEQTSEY
FT                   YSASDESELDESLLSDTPGLRGNGKCNDLFRVISGRVSVCCRRVVEALRRFVLHVGDRL
FT                   YSRIMDSFVRLFVRISTAARNCESFAINCITKVSDLVVGCITWRNLHSGAYSTTPGLSG
FT                   GSRNSLSRFLDDSLACVIQNFVTAWLTVFNETFYSSLAHRMRTTSINVLLEFLKNLPVC
FT                   LVSIYTFIECRSRIFPLKEFLWGFCVFVWNIVVELSTCIYENLPVCITRLINRAFRRSS
FT                   NEGDVRTLQVITEAENRIEFLREVPAEMARFRASLEMPVPGSLNSPLFPPTYGEIEELG
FT                   SDSSDSARVIGVDNGSDSMPTEGETEPDSDGDSDDSMPLDRDFEQIGGLGGSGNVDVFR
FT                   LGLRFVWRVSRSLFNLKGVKFSYGLALQCIFNGGSMGQFMSRLLFSFGNCLPFEFFRHI
FT                   CAVRWLSKSLALRIRNANVCDEETVERFFGFSRFLYESRYISDALSVLERLDFYLSYLF
FT                   SLPKRCFTHNRSVQVCVRAPVRVIRDVGLVKDGNKSLTEVLNSLDSLKVSDCKGKSAVI
FT                   ESDCSDSESGHSFGSISFGSVNEEVLEAANGRVVSEKAPLMKHAAALSRLESDRSGKKD
FT                   LPIVRRNFTRGECSGTKPVGGLCVYLTTLNSSFGSVPDLYPVARDITYKKMTNAMREFY
FT                   YSQKVTLYELHGKLSSYWDELKTVGFDRKLAKMDSDDDVSVVDFNMKVIVGRHGTRPFK
FT                   NTVNSHEFMFCDDGLVLCPGPKKRDFALISSQTQFVAANSFLRAVDGKDLTFTNSEHSL
FT                   IVYEAPPGGGKTHSLVTYFADYCTKVSCLVVTANKNSQAEISQRISRELMDRKMLAKHV
FT                   IKTASRVFTVDSYLMNHIRLKTDLLFVDECFMVHAGAIGAIVEFTSCKAVVFFGDSRQI
FT                   HYIHRNDFGVSLLHDIDAFIEPQHRIYGEVSYRCPWDICEWLSKFYPRHVATANTGSVG
FT                   KSSVSIEIINGCDDVPYDSSAKYIVYTQAEKNELQKHLGRLTVGRTKAVPIVNTVHEVQ
FT                   GETYKKVRLVRFKYQEDTPFCSDNHVVVALTRHVDSLIYSVLNSRRYDKTASSIDEARE
FT                   IFDKFRSTNHSHGSSTLEWYLEKYPTEYKGSKASSAPLSCINEFLNEVIVGSSVVQLGD
FT                   TSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVAGDSTKKSIPTRKSSVVR
FT                   KS"
FT   CDS             <9379. .10812
FT                   /codon_start=1
FT                   /product="ORF1b"
FT                   /protein_id="AGK38323.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPEDFGKAM
FT                   AAAVFERCFKMDEVAKIRSDIIAFTEANIQKWLDKRTPCQVKSVQAELKLPFAVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIYSPCFDEFKNRVLSSLNGNIV
FT                   FFTEMTNAGLAEVIRRVIGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDDEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSKEKIGNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQYKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVETKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDAMKLRQLRKFANLICERVVYDNRVGYFSYFD
FT                   NPFTKPDASDGQADDLATG"
FT   CDS             10861. .11772
FT                   /codon_start=1
FT                   /product="p33"
FT                   /protein_id="AGK38324.1"
FT                   /translation="MFAFASESQDILEEKIFRRRTRHRKYLDDVVKDFTIDVGYDTVDR
FT                   DPTVLADYFSLYFFLLNNDNIGPLAASIVVSPPVNGTYKIRAHVDNQPNREGNVTYVKT
FT                   MDKSRFVIRIKAIPASMRGYYSFRAFLSGDVASERSEFICSFVGSKFLCCCTQTISENL
FT                   GKVCSSCFFFRAVSETATNEFSVVTDDVEDVKYVRKRVEGFSHCADPYPPRCYRNANLG
FT                   DSSGVQSRTIEEEGYRMDNAGNVAITIPNTPLVNAVSPYVAEYNENALSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAVIFI"
FT   CDS             11842. .11997
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="AGK38325.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12003. .13787
FT                   /codon_start=1
FT                   /product="p65"
FT                   /protein_id="AGK38326.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYEVVVKEFGTKSMP
FT                   VPYLSPLNNNLGLSVALPSLIASYAKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTHYG
FT                   MSETVSIDQTTLREIASVFITRTIDILTQVKAKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIVPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTKVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERVPL"
FT   CDS             13711. .15327
FT                   /codon_start=1
FT                   /product="p61"
FT                   /protein_id="AGK38327.1"
FT                   /translation="MSSRHVWGSLFRKFYGEAIWKEYLSESTRNFNERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVELTGMPLDSLMTGIEDRKVPDELISV
FT                   DPHEVGCRFTLDDVESYLMSRGEDSTDVTAVEHSWCLSNSCGRLLSSTEIDAYKTMVFT
FT                   KTFDSNVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYHSTFKVNLDNVRLFKSRVLPVVLTVWDISEPDDPVDER
FT                   TLVPFDPMDFMLDIPKLNIHDTMVVVGNQIRHLEHVLESDALDDLSQHVDLNLAADNPD
FT                   LRVDLRWAGMFVYYGIYRCAVDRVVERPALFNLPQKLLSQDDGESCLLRMSSVETLFNL
FT                   VQKVNKDINIRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPAHHGYLYVDFYKRVPDD
FT                   AVDADELESLRQLRSSVDVMCKDRVSITPPPFNRHRRGSSRILRGRGARGASSRHMSKD
FT                   VATSGFNLPFRHGRSYDTSQS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27"
FT                   /protein_id="AGK38328.1"
FT                   /translation="MAGHTILPKVDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIES
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLTMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLFDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYI"
FT   CDS             16110. .16781
FT                   /codon_start=1
FT                   /product="p25"
FT                   /protein_id="AGK38329.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16747. .17250
FT                   /codon_start=1
FT                   /product="p18"
FT                   /protein_id="AGK38330.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSE
FT                   DVLNSFSAISNCTIIADGSALLKDNTVVDRLEGLNPLAYLLKLARTTTTICFTMSNKVL
FT                   FCTTKSEPLSCLAVTSDRVLFKVIMGTNVDDSRCGCSIWFYDNGTFQNGLTRCNNLVAL
FT                   FSAT"
FT   CDS             17284. .17643
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="AGK38331.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGTANESRADRTNISEIVESHMSDRDRMSILL
FT                   RNKRIQIPSLLPCGN"
FT   CDS             17719. .18267
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="AGK38332.1"
FT                   /translation="MRAYFSVNDYISLSAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNSDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHISFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
FT   CDS             18350. .18979
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="AGK38333.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVGSEADRLEFLRKMNPFV
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHEKGSRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLSKRKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARKHPMRSPEETPEH
FT                   YKFGTTAKAKLPDVDVVDVGDNEDTSSEYPISLSVSGGVLREHHFI"
FT   3'UTR           18980. .19253
XX
SQ   Sequence 19253 BP; 4758 A; 3831 C; 4894 G; 5770 T; 0 other;

kc525952 Length: 19253  01-MAY-2013  Type: N  Check: 1243  ..

       1  aatttctcaa attcacccgt accctccgga aaacacgtcc ggacgctgcg
      51  ggatttggtg taggtccagc cttgaggccc cactacgccc atgtaaacaa
     101  acacaacatg tcgaaactcg gagctagctt cgagtcctcg actttcgctg
     151  tacgcagcga ttacgtaatc tcgcgcatct ggcgcgcctt taacgccgtt
     201  ggagtcctgc acttcttcgg cactgaaaca accaccacgg tggttaagga
     251  gttttcggct gctgggccga ttgtcccttt acggaaatcc tgttttccgt
     301  tttctgttcg cgctgctgtt cgcgcgatta aagctgctgg acgtcccatt
     351  gacgctccac gctccggatg cctctgtggc ctccctgttg tcgacacatc
     401  tggtgtcgta cgtccccgct ctgttgcggg cgtttggagg ttttctctgt
     451  ctaaacctcc cctctctgcc gccgccaaga agtccattcg caaggcgaag
     501  aaagattctg ctttctttct tagccgggct tcttcactct tctcacggga
     551  agtcccttgc ggcacgcgtc atagacttcg caggcgcgtc gagaaacgag
     601  ttgaccccac catggatgag agtccccaag acgagatcaa attaaaggga
     651  cgccgacatg gcagaagatc tgacctccca tacatggggg aagcagcgtt
     701  ggatgatatc cttcgctgga ttgagggggt aaaccccccg ccgtcgatgg
     751  tcgccattcc ggtgcccatc tcatttggca ctctgcctac gacggcttgg
     801  tgctctgaag ccgacgccaa agttttgcgg tgtcgcttag cctaccatgc
     851  cgctgagact tcctttcgta acgaagggaa gcatgtgaga tacgtctata
     901  atgacgtgtc ttctgctgct aaccgtcctc gtacggtttc tccccgcaag
     951  tgcgggcgcg tttttcccag cggttctgcg ctgggtgttg aggtcccgag
    1001  cgtcagggac cgccacaccg ctttcgtgag atccgctcac gctagcgtct
    1051  tcttttctga cgcggttcgc cgcgttcgca tgttccgtcc tgggcggaat
    1101  aatttcttta ctagcgtcgt cagtgggcgg cgtgtttgtt atttcagacc
    1151  cggacctaac ggtacggtct ctattctaat gtcggatggt gtcaatacag
    1201  ctcgcctcga cgttgtcgct cctgcgtact atgagtacgc taaagcgttg
    1251  ggcgccaaag tgcgctgctt gtgggagtcg tccgatttgg acgacgctaa
    1301  agtgcgtgac ggccaatgct atgttcgtca cgtgtacgac gtggcccttt
    1351  acttcggaag gcgcgtcgat ctttcagtgc gccgtgcttt gggcatgttt
    1401  cccacagtgg gcgcattaaa gacttacctt gttcgcgagt acggtcgcga
    1451  atctttgaag gttccgatgc gtgggaccta cacttttggc agtgtgtttc
    1501  attgcctgtc gactaaatct tttgtcgact tgagatctat tcctaaccat
    1551  catctggttg gtggtgcgtc tgctcatgtg tttgttgggc agattcgtct
    1601  tgacgtcgct ggtagcatct ctaaaccgtc tcgatcagct gttcgcaggc
    1651  gtaataggcg tttgcgtaaa gacggttttc taggtagttc cgattcgtct
    1701  tcttcgggag agtcgagata ctgttcggat tgttcaactc ctcgcagttc
    1751  accctctccg tcggttattg ggcctactct cggtcggata ccaagtataa
    1801  accggaaatt ccggtttcca gcaggcactc agttgagtgt ttctatccct
    1851  aaacgcgatg atgatcgcgt gtatgtgtcg cacggtcaag actttgatga
    1901  gctgtgccat gccgtgtgta cttacgtcaa gaggtacaac tcgaggaaag
    1951  tgttttacac gcgctttgaa aacggtgaag actttgccgt cattcggcgt
    2001  gcttcagtcg gtggtcttca cgtgtttgtg aaacgcggta atttcacagc
    2051  tcgcttccct gtgtcggctt cgaggtatga gcatcattat gatgcgagta
    2101  tgaaaggcac cggtttgtcg tgggtgagga agagtcggtt tccaaacgtt
    2151  gaagttatac gccgtcggag gagtcgggca agtaattctt ctgctaacct
    2201  tccagacacg aatttacgag ttaactctga ccaaccgtcg gagtctattc
    2251  aaacggttcc ggtgctgaat gaaaattctt caccgtttcg aggagtatcc
    2301  tcgccccaac gcgatcctgc tgaagggtcg ggctggtgta aggtgggttc
    2351  tcctagtcgg cgctcgaata ccgctcgtgg gcaacgttcc accgaacgta
    2401  ggaagatagg ggattttagt tttccgagtg gtaccacgta caacgtacgt
    2451  gtcgacgagc gtgcttataa acgtgtcttg aagttgcggg acacgtcggc
    2501  gtcctccttt cttcgtatag ttttggctcg tttatcgagt tatcggcctc
    2551  ttagtgacga gttctttaac aagtgcgtta cttctcggtt tgtggcttgt
    2601  atcgaggcgg ttgagtcggg tctcgttaca gtacactttc gatctgacgt
    2651  atttcgcgct tcattcccgt ttggcgttta tttgtacact cgacacgcat
    2701  ttgacattta cagtggtaag ctcctgcaat tagatacgta cgggttttcg
    2751  gaagacctaa gggacggcta ctgctacatt cgtcacattg ctgaggtctg
    2801  tttgagtatg gggaaggttt tctttaggag ggacgttaat ttaggggcgt
    2851  tcccttatgt tttcgaagtg cagcaccgtc ttgagcggtt gtatggtaag
    2901  cgggctgttg aatacagcgt tagaggttac ttttcagcac cgcgtctcta
    2951  ccattgttgc tttactgatt cacccaaacc ctttagatct ttaaataagt
    3001  atcataagat gggtggcgaa gaaggtgcgt tgttaattac tgacactgac
    3051  agattgcgtg ccgtggggag tgcttacgag aaggtgaaag ggcgtttgcc
    3101  cgattcttta ctcgttcgat cagtagagaa agatttgata gaattcaatc
    3151  aaactctggt cgatatgcaa cgggctagac ccggtgttgt agtgcctttt
    3201  cagatgagtg agaaccaaca ggtgatgctc actagagctt atcctgagtt
    3251  taatataaac tttattcatt ccgtacactc cgatcatccc gtggctgcgg
    3301  gttccagaat gttagagaat caccttgttc gcaaatatgc aggtagcgac
    3351  tattcagatg tgggtggttg cccatcattt catctgcgtg caggtcacgc
    3401  aggagttcac gtttgcagac cggtgtatga tgttaaagac gcccaccgta
    3451  aagttattcg tcatcatcaa cttagtaaag tagctttaga tcatactgac
    3501  gggtttaagc aggttggtgc tgtcaatacg aatactgtgt gcggcaacgt
    3551  tttaggggag tgttttcatg catctgaagc gattgtcatg gtgcaggttt
    3601  atgacgtgcc attgcgagaa ttgtgtagag ctatggtaaa taagaaagct
    3651  tcggtgtgtt acatgaccat ggttacgcct ggtgagttgt tggacgcccg
    3701  tgagtccttc tttatcaagg atttggactg ttcggtggag ttggacgtta
    3751  tcgccgatag ggtcgtttac tgctttaata attcagcgta cacgcatacc
    3801  tattctacga tacgtgagta catgcgcact ccttgtacag tggtggacgg
    3851  ttttctgttc actatagaga tggtttcgct caggtgcagc gttaattatt
    3901  attgcatcac caaatcgcgg gtttgtccga gaattagcga gaccaaacgg
    3951  ttacgctatc gtcggtgtga tagtgacttg attaggatta agattcctcg
    4001  gtactctagc aagactcgta gctgtttacc agggtgttgt tatttgtact
    4051  tggacgctaa gtttgtgagt cgtgtgtatg agtacgtagt taacaattgt
    4101  gtcgtggtga atgctaagac ttttgaatgg acttggaatt acatcaagtc
    4151  ctgtaagtcg agagtggtca tcagtgggaa aatcatccat agagacgttc
    4201  ctatagcatt ggagtatttg gatgggtttt ccgcagttat gctgtccgcg
    4251  ggcgtgaaag gtaggcagaa cgcagaagcg ttttctaggc gtctggccgc
    4301  cttttcaggg gacacctctc ttttcgaact agtaaggttt gccatttcag
    4351  aaaagtgtcg tgacttattt gtgggcatcc aggaagctgt ggagaaatgc
    4401  gtgagatcgt accttagaaa ctcttttaat atgaatttcg tagacttgtc
    4451  agatcctttg cttactatta gtgagtactc ggagttagac gttcctatcg
    4501  atttgccggg tttcggctgt ataacggaag aggacgaggc taaactcata
    4551  gaagatgggg ttaaatcggc tttgctacga aaagcagttc gtgacgaggc
    4601  gcaactcatt ctcgataggg gcagcacgtc ggagatcgtt ccttgcgggg
    4651  atgacgatgg ttcagacggt gacggttcgg acgatttact cgggtccggt
    4701  agtgattcat cttctaaagc tagttctggt ggtttgcggg ccggagccgc
    4751  cccttcactg tttagaagct tgctgaagaa gttgggtggg ggtttttgtg
    4801  tggccaaaag gttattggac ttgttgtgcg agcgattagt tggttcgtta
    4851  tcacgcctaa agtttggtac cactcattta acctcaattt ttagcacgtt
    4901  acgcattaag ctttcgtgta atttttccga cgactcgatt tttaccgctg
    4951  tttgggacgc ggtgatgaat ttgattagaa tcgtcaacgg ggcgaccaag
    5001  acgaaattgg agtcttttcg caacatactt cggttaattc ctaagttgtg
    5051  ttttgattgt aaaacctttg tgaaagactt cgcagacatg tgtaggtcgg
    5101  ttatgctatt ttctacggag ttcttcagta aaagctatac taaactgtgt
    5151  cggtttggtt tggaaatgtt tgatgtcggg cttattgaaa tttcagcccg
    5201  taacatggga ctagagactt gtgtttcgat ggcttcggct atcttcgatg
    5251  tcatgcttac ctatcctctg ggaagtatta gctttcccat cgtttgcgcg
    5301  agggtttttg gcgccctcgc tatggaagtg ggatcgaact attgttttaa
    5351  gaaaactttc ggcaaacctg aagttttagg agaggacgct tttcgtagaa
    5401  cggtaagtat ggtgttgagc gctaaggctt tcgacaaact ttcggtcgat
    5451  ggtaagggtt tagttaggtg ttctggtgtt attcctggag tgttgaggat
    5501  agtattttca tctttatttt ccgacgccga tacgtgggtg ggttatagta
    5551  aacacgaagt ttcctcactt cccataatca cgtatagtgc gaaaaggtta
    5601  tctttcgtgt tggagcagac taaggaagcg tgcatcgctt tcataatcga
    5651  ttcatctaag aggatcttag cgtctttgac ctcggagatt cacgagtctt
    5701  tccgagactc ggaactaact agtggcgcta agtccttata cggacatgtg
    5751  agttctatac tctctgtgtc cagtggtgtg gttaacaaag caggaaacgc
    5801  cgttgcggca gttaaagcgg cggggagtgg tcttagtaaa cgtgtgaagc
    5851  gtattcgtcc ttcttttcgc cttgctcggt gtgttaatga acagaccagc
    5901  gaatactact ctgctagtga cgagtctgag ttggacgagt cgctgcttag
    5951  tgacacaccc ggtcttcgtg gtaacgggaa gtgtaacgat ttatttcgtg
    6001  tcatttccgg acgtgtctca gtatgttgta ggcgcgttgt agaagccttg
    6051  aggcgttttg ttctacacgt cggtgaccgc ttgtactcgc gcattatgga
    6101  ctcttttgtg aggttgttcg taagaatcag tactgcagcc aggaattgtg
    6151  aatcctttgc catcaattgt atcacaaaag tttctgactt agtggtcgga
    6201  tgtattacct ggcgcaacct tcattccggt gcgtattcga cgactccagg
    6251  gttatctggt ggtagtagaa attctctttc caggttcttg gatgacagtc
    6301  tcgcgtgtgt gattcaaaat tttgttaccg cgtggttgac agttttcaat
    6351  gagacttttt attcgagcct ggctcatcgg atgagaacca cctcgataaa
    6401  tgtgttgtta gaattcctga agaatctccc ggtctgttta gtttcgatat
    6451  acactttcat agagtgtaga tctaggattt ttcctttgaa ggagttcctt
    6501  tggggctttt gcgttttcgt ctggaacatc gtcgtggaac tttccacgtg
    6551  catttacgaa aacctccccg tttgcattac gaggttgatt aatagagcat
    6601  tccgtcgcag ttccaatgaa ggcgatgtgc gcacgcttca agtgatcact
    6651  gaagctgaaa accgaatcga gtttttgcga gaagttcccg ccgaaatggc
    6701  gcggttccgc gcttctctcg agatgcctgt accggggtcg cttaacagtc
    6751  ctttgtttcc accgacgtac ggtgagattg aggaattagg tagcgattct
    6801  tctgacagtg cccgagtaat aggtgtggat aatggctcag attcgatgcc
    6851  cactgaaggc gaaacggaac cagattcgga tggtgatagc gacgattcaa
    6901  tgcctttaga tcgtgacttt gaacaaattg gaggtctagg aggaagcggt
    6951  aacgttgacg tctttcgtct agggctgagg ttcgtgtgga gagtatcacg
    7001  tagtttattt aacttaaaag gtgttaaatt ttcgtacggg ttagctcttc
    7051  aatgtatatt caacggtggg tcaatgggcc agtttatgtc gcgactgtta
    7101  ttcagtttcg gcaactgctt accgtttgag ttctttaggc acatttgtgc
    7151  cgtgaggtgg ttatcaaaga gcttggcgtt acgcattcgt aacgctaatg
    7201  tttgtgacga agaaacggtc gaacgtttct tcggtttttc acggtttttg
    7251  tacgagtcgc gctacatatc ggacgcgctt tcggtgttgg agaggttaga
    7301  tttttactta agttacctgt tctcgttgcc gaagaggtgt tttacgcata
    7351  accgtagtgt tcaagtttgc gttagagctc cagttcgtgt gattagggat
    7401  gtggggcttg tgaaggacgg caataaatct ttgaccgaag tgttgaactc
    7451  tttggactcc ttgaaggttt ccgactgtaa agggaagtca gcggttattg
    7501  aaagtgattg ttccgattct gagagtggtc attcgttcgg ttccatttcg
    7551  tttggatcgg tcaatgagga agttttagaa gcagcgaacg gtagagtcgt
    7601  ttctgaaaaa gctccattga tgaaacatgc ggctgcatta agcaggttag
    7651  agtcggatcg tagtggtaag aaggatcttc ctattgtcag gagaaatttt
    7701  acgcgcggtg agtgttcggg tacgaaaccg gtggggggtt tgtgcgtata
    7751  cttgacgacg ctaaattctt cgttcggttc ggtgcctgac ttgtatcccg
    7801  tcgcgcgtga cataacgtac aagaagatga ccaacgccat gcgcgagttc
    7851  tattattcgc aaaaggtaac gttgtacgaa ctccatggaa aattgagctc
    7901  gtactgggac gagttaaaga cggtaggctt tgataggaag ttggcgaaga
    7951  tggattcgga cgatgacgtt agtgttgtcg attttaacat gaaggtaata
    8001  gtgggaaggc atggtacccg tcctttcaaa aatactgtga actctcacga
    8051  gttcatgttt tgtgacgacg ggttggtgct ttgcccgggt ccgaaaaaac
    8101  gtgactttgc tttgatctct agtcaaacgc aattcgtcgc tgcgaactca
    8151  ttcctacgtg ctgtggacgg taaagatttg acgttcacta attcggagca
    8201  cagtctcata gtttatgagg ctcctcccgg tggcggaaag acacattctt
    8251  tggtgacgta tttcgccgat tattgtacca aagtgtcttg cttggtggtg
    8301  accgctaata aaaattcgca agcggagatt tctcaaagaa tctccagaga
    8351  gttaatggat agaaagatgc ttgctaaaca tgttattaaa accgctagta
    8401  gagtgttcac cgtggactct tatttgatga accatattcg acttaagact
    8451  gatttgttgt tcgtcgatga gtgttttatg gttcatgctg gagcgatcgg
    8501  agcgattgtt gagttcactt catgtaaagc tgtggttttc ttcggtgata
    8551  gtagacaaat tcattatatt caccgaaatg atttcggcgt ttcgttgttg
    8601  cacgacatag acgcatttat agagccacag catcgcattt acggtgaggt
    8651  gtcttacagg tgtccttggg atatctgtga gtggttgtct aaattctacc
    8701  cgaggcatgt ggctactgct aacactggta gtgtcgggaa atcaagtgtg
    8751  tctatagaga taataaatgg atgtgacgac gttccttacg atagtagtgc
    8801  gaagtacatc gtttatacac aagcggaaaa gaacgaactg caaaagcacc
    8851  ttggtcgttt gaccgtgggt cggactaaag cagtacctat tgtgaacaca
    8901  gtgcatgaag ttcaagggga aacgtataag aaggttcgtt tggtaagatt
    8951  caagtaccaa gaggacactc ctttctgttc ggataatcat gtcgttgtgg
    9001  ctttaaccag gcacgtcgac tccttaattt actccgtttt gaatagcagg
    9051  aggtacgaca agaccgcttc cagtatagat gaggcgaggg agatttttga
    9101  caaatttcgt tcgacgaatc attctcacgg ttcttcaacg ttagagtggt
    9151  acctagagaa ataccctact gaatataagg gtagcaaagc atcttcggcg
    9201  ccgttaagtt gtattaacga gtttcttaac gaggtcattg tcggttcttc
    9251  agtcgtacag ttgggagaca cttccgaaga attaagttct cgtccttttg
    9301  aatctggatg tgataatgtt accgtaaggg acactgctcc cccagactct
    9351  ggtaatctac acgaaccggc tcgcgttcgg cgtagtaagg tcgcaggcga
    9401  ttccaccaag aaaagcatcc ctacaagaaa atcttctgtc gtacgaaagt
    9451  cgtaactaca actttataaa gacagaacga tttgtggggc ccgaagattt
    9501  cggtaaggct atggccgcgg ccgtttttga gaggtgtttt aagatggatg
    9551  aagtggccaa gataagaagc gatattattg cttttactga agccaatata
    9601  caaaaatggc tcgataaacg taccccgtgt caggtgaagt ctgtgcaggc
    9651  cgaattgaag ttaccgtttg ctgtggaaga gcaaatcacc aactacaaac
    9701  taatggtcaa gcgtgatgct aaagtgaaac tcgatgattc gagtctgtcc
    9751  aaacatcccg ccgcacagaa catcatgttt cataagaagt tcatcaatgc
    9801  tatctactct ccgtgtttcg acgagttcaa gaacagggta ttatcgtcac
    9851  taaacggtaa tatagtattc tttactgaga tgacgaacgc tgggttggcg
    9901  gaagttatca ggagggttat aggtgatgac gacaatctgt ttgtagggga
    9951  agtggatttt agtaaatttg acaagtctca agatttgttc attaaggagt
   10001  atgagcgcac gttatattct gagttcgggt ttgatgacga actcctcgac
   10051  gtgtggatgg aaggcgagta ccgcgctagg gctactacgt tagacggtca
   10101  gttgagtttt tcagtcgatg gccaacgtcg ttcgggaggt tcgaatacat
   10151  ggattgggaa ctctttggtt accctaggta tcctatcttt gtattacgac
   10201  gtctcaaaat tcgagctact actcatatcc ggcgacgact ctttgattta
   10251  ttcaaaagaa aagattggta acttttcttc agaaatttgt ctggagactg
   10301  gttttgagac taaattcatg tctcctagcg taccatactt ttgttcgaag
   10351  tttgtggttc aaactgggaa caaaacgtgt tttgtgccgg acccttacaa
   10401  gctgttggtt aaactggggg cccctcaata caaattgact gatgacgaac
   10451  tttttgagct gttcacctct tttaaagaca tcactcagga ctttggtgat
   10501  caggtggtcc tagagaaatt aaagttgttg gtagagacta agtacggctt
   10551  tactagcgga actactatgc ccgctctatg tgctatacat tgcgtacggt
   10601  ctaactattt gtcttttgaa aggttgtttc cctttattag aggttggtat
   10651  gttgtcgacg ctatgaagct tagacaacta aggaagttcg ccaatttgat
   10701  ctgtgaacgt gtggtttatg acaatcgcgt gggttacttt tcgtactttg
   10751  acaatccatt tactaaaccc gatgctagcg atggtcaagc ggacgactta
   10801  gcgacaggct gatagtttgt tcagttctcg ctgagagcta acacaggtag
   10851  ttgagtcgag atgtttgcct tcgcgagcga aagtcaagac atattagaag
   10901  aaaagatttt tcgccgtagg actcgccatc gtaagtattt ggatgatgtg
   10951  gttaaggatt ttaccattga tgttggttat gatactgtcg atcgtgatcc
   11001  cacggtatta gctgattatt tctcgctgta tttctttttg cttaacaatg
   11051  ataacattgg gcctttagca gcttcgatcg tagtaagccc acccgtgaat
   11101  gggacttaca aaattcgagc gcacgtcgat aatcaaccga atcgtgaagg
   11151  aaacgtaact tatgttaaga ctatggacaa gagtcggttt gtgattcgca
   11201  taaaagcgat accagcttct atgagaggtt actactcttt tcgagcgttt
   11251  cttagtggcg atgtcgctag cgaacgtagt gaattcatat gtagttttgt
   11301  tggtagtaag ttcctttgtt gttgcaccca aacgatatcc gagaatttgg
   11351  gtaaagtttg ttcgtcctgc ttcttcttta gagctgtttc ggaaaccgct
   11401  actaatgagt tttctgtcgt gactgacgat gtagaagacg ttaagtacgt
   11451  aaggaaacga gtcgaggggt tttcacattg cgctgacccg tatcctccta
   11501  ggtgttatcg taacgctaac ttaggcgatt cttcaggggt tcaaagtcgc
   11551  actattgaag aagaaggtta taggatggat aacgcaggta acgtcgcgat
   11601  caccataccg aacactccac ttgttaacgc cgtctctccg tatgtcgcag
   11651  agtacaacga aaacgcgctt tcgcgtattt cattaatacg gcgagtttgc
   11701  tgttatgccg tttgcgtttt agtggtgtct cttcttataa tgagcggttt
   11751  gttagccgtt atattcatat gatttggtgt agcaacttat gaggtgtaat
   11801  tagctaaaac tcgccgtttg actctgttta aacggggttc aatggactgt
   11851  gtgattcaag gatttttgac ttttctggtt ggcatagctg tattttcggc
   11901  ttttgccgga ttgattatca ttgttataac gatctatcgg tgtacgacta
   11951  aacctgttag aaacacctct ccttacggca ctcacgccac tgtctaagcg
   12001  gtatggtgct tctgggttta gattttggta ccacgttttc gacggtggct
   12051  atggctacat cttctgagtt agttatactt aaacaatcca attcgtcgta
   12101  catacctacg tgtttgtttc tgcacgcgga ccccaacagc gtatcttatg
   12151  gttacgacgc ggagtattta gcggcttcgg gggaacctgg ctcattttac
   12201  aaagatttga aacggtgggt cggttgcact gagaagaact accagagcta
   12251  cctgcacaag ttgtcacctt cctatgaggt ggtagtgaaa gaatttggaa
   12301  ctaagagtat gccggttccg tatttgtcac ctttgaataa caatctcggg
   12351  ctcagcgtcg ctttgccttc attgatcgct tcatatgcca aatccatttt
   12401  atcggatgca gaaagagtgt tcaatgtgag ttgcactgga gttatatgtt
   12451  cggtacctgc tggttataac acgttacagc gagcttttac gcaacaaagt
   12501  gtgtccttgt cgggttactc ttgcgtgtat attattaatg aaccttccgc
   12551  cgccgcttac tccactttac ctaagttgag ttcggcggat aagtacttgg
   12601  ccgtttacga ctttggtggt gggacttttg atgtttctat agttagtgtt
   12651  aggttaccca cgttcgccgt tagaagttca ggtggtgata tgaacttagg
   12701  cggcagagac atcgatagaa aattatctga taaaatatat gagttggccg
   12751  actttctacc gcaaaaggaa ctgaatgttt ctagtttgaa ggaagcttta
   12801  tctcttcaga cagatccagt caaatatact gtaactcatt acggcatgag
   12851  tgaaaccgta tcaattgatc aaacgacgtt gagggagata gcttcggtgt
   12901  ttataactcg aacgatagac atacttacgc aagttaaggc taagtctagt
   12951  atgcccgagt cgcaaagttt gaagctagta gtggtcggtg gaagctcgta
   13001  cctgccgggg ttgttggaca ctttggagac cgtacctttt gtgtctggga
   13051  tagtaccagt ggaagacgca agaaccgctg ttgctagggg gtgcgcttta
   13101  tatagcgaat gcttagatgg taggtccaag gcattattaa tagactgtat
   13151  tacgcatcat ttgtcggtta cgactttcag tgcggactcg gttgttgttg
   13201  ctgcggccgg aagtccgatt ccctttgaag gagaacgaaa gctcacgtta
   13251  cgcaagtgtg ttagtacgtc aaattatcaa gcaagaatgt tcgaaggaga
   13301  ttacgaaaaa gttttccgaa acgaacgtat atacgcggct tcggtatctt
   13351  tgtttacttt aggagttaac tggcgcgtgc ctaacgacgt tgagatgact
   13401  ctcgtgacca aagtagactc gatgggtaaa gtggaattct accttaaagg
   13451  tccatctggt gaattagtta acgtgcaagg tacttcacat tatgattatg
   13501  ttggtatgcc tcatcccact agaaagttgt tgaggcttag cgattacaat
   13551  gtaaactccg ccgctttagt tttagctttg acgttgactc gcgaaaaacg
   13601  ggagaaattt cttttgcgaa cattgtttga tgctttatta gcagacttgc
   13651  gaaagaccgc aagtttaagc gaatattcta agaaatatcc gattactcga
   13701  aacgacgtcg atgtcgtctc gtcacgtatg gggatcgttg tttcgaaagt
   13751  tttacgggga agcgatttgg aaagagtacc tctctgaatc gactcgaaat
   13801  ttcaacgaga gaaatgtatc gctggaccac actttaagtt caggtgtggt
   13851  cgttcgtagg caaagtcttt tgaacgcgcc tcaaggaaca ttcgagaacg
   13901  agttagcgct actgtacaat tcggtagtga ttaacgattt tgttgagttg
   13951  actggtatgc cattggattc tctgatgaca ggtattgagg atcgtaaggt
   14001  acctgacgaa ctaatatcgg ttgacccgca tgaagtcgga tgtagattca
   14051  cgctggatga cgtagaatca tatctaatga gcaggggtga agattccact
   14101  gatgtaacgg cggtggagca ctcatggtgt ttgagcaatt cttgcggtag
   14151  attattaagt tcgacagaaa tagatgctta caaaaccatg gtatttacta
   14201  agacttttga cagtaacgta tctggggtga ccactaaatt agagacgtac
   14251  ctatcgtact gcatatcatt gtacaagaag cattgtatga aagacgatga
   14301  ttattttaac cttatcttac ctatgtttaa ttgtttgatg aaagtgctgg
   14351  cgtcgcttgg tttgttttat gagaaacata ccgacaatcc gttgctgacc
   14401  ggcatgctca tagagttttg cctagaaaat aaggtgtatc actctacttt
   14451  taaagtaaat ttggataacg ttaggctgtt caagtctaga gtgttgcctg
   14501  tggtgttaac ggtttgggat atatctgaac ctgatgaccc ggtggatgag
   14551  agaacactag ttcctttcga tcctatggat ttcatgctcg atatacccaa
   14601  actgaatata cacgacacaa tggtggtagt ggggaaccaa attagacatt
   14651  tagagcacgt acttgagagc gacgcattag acgatttgtc tcagcatgtt
   14701  gacttgaatt tagcagcgga caatcccgat ctacgcgttg atttgcgttg
   14751  ggcagggatg tttgtgtatt acggcatata tcggtgtgct gtggatagag
   14801  tggtggagcg accggcatta tttaatttgc cgcagaagtt gttgagtcag
   14851  gacgacggtg agtcgtgctt gttacgcatg agttccgtcg aaaccttatt
   14901  taatttggtg cagaaggtaa ataaagacat aaatattagg cgtcaattca
   14951  tgggacgtca tagtaaagtg gctttgcgat tgtaccgcaa tttaggtttg
   15001  aggtttccac caatttcttc agttaggtta ccagctcatc acggctactt
   15051  atacgtcgac ttttacaaga gggtacctga tgatgctgtt gacgccgacg
   15101  aacttgaaag tttacgtcaa ttacgttcat ccgtggacgt catgtgtaaa
   15151  gacagggtat caatcacacc tccaccattt aatcgacata gaagaggttc
   15201  ttctagaata cttagaggtc gaggcgcacg cggtgcgagc tcgcgtcata
   15251  tgagcaaaga cgtggcaact tccggtttta atttaccctt tcgtcatggc
   15301  aggtcatacg atacttccca aagttgatga caaagaaatg gatccagtaa
   15351  gtgctgctgt acccggcaaa tacccggacg tcatcgaaaa atttgtgact
   15401  aataggtcgg tagacgcgtt aatagaaagt gttataagca agttggacac
   15451  caattcgata tacgaagact ccactgaaaa atttactggt gagcaactga
   15501  agtatgttat ggttactatg gatactttct tattagaaaa ttacaaaacg
   15551  aaaacggaag atctactggt tcatctgact atgattcaga agaggttgtg
   15601  cactatatcc acgagtacta aaaccaaatt tcgtgataag ggttgtatta
   15651  gttatgtaca agggggttta cgatataagc tgttcgataa agtagttttc
   15701  ccttttatta tatccaagtt taccgacagg gagaccccaa acgctctacg
   15751  taagtatgct tgtacctttg aggagttaca cttgtgtatg gctagattaa
   15801  gacccgacct atacgaaaac aaaaggacaa ccaaagctgg aactccgcat
   15851  ttaaaaggct acttgtcagc tgattttctt acgggttctc ttccaggata
   15901  ctccgaacac gaacggggta tcattcttcg agcgtctgaa tctatgttag
   15951  ctagacgtca aggttacgag gaggcaaccg agcttcttaa cttacgcgat
   16001  ttgggaaagt acatatagtt agtttgggga cggtgatatt gcgccatccc
   16051  ttgagcactg ctttaagggt cgttaattaa cgactcttga tatttactaa
   16101  gtttaagtta tggacgacga gacaaagaaa ttaaagaaca aaaacaagga
   16151  gacgaaagaa ggcgacgatg ttgttgcagc agagtcttct ttcggttccg
   16201  tgaacttaca catcgatccg actctgatag cgatgaacga tgtgcgtcag
   16251  ttgggaaccc aacagaacgc cgctttgaac agagatttgt ttcttactct
   16301  gaaagggaag tatcctaact tgtctgacaa ggataaggac ttccacatag
   16351  ctatgatgtt atatcgttta gcggttaaga gttcatcgtt gcaaagtgat
   16401  gatgacacca cgggcataac atatactcgg gagggtgttg aagtggaatt
   16451  gtctgacaag ctttggactg acgtcgtgtt taactctaag ggtattggta
   16501  accgtactaa tgcccttcga gtctggggta ggactaacga tgccctttat
   16551  ttagctttct gtagacagaa tcgcaatttg agttatggtg gacgtccgct
   16601  agatgcaggg attccggctg gatatcatta cctatgtgca gatttcttga
   16651  ccggagctgg cttgactgat ttagaatgtg ctgtgtacat acaagctaag
   16701  gaacaattgt tgaagaagcg aggggctgat gaagtcgtag ttactaatgt
   16751  caggcagctt gggaaattta acacacgttg atctattgcg ttctgattcc
   16801  cggtttctat cgggatggtg gagtttcatt gttaacgtgg gtgacataat
   16851  cgtccggttt gcgttacatg ttcctagtga agatgtgctg aatagttttt
   16901  cggctatatc gaattgcaca atcatagcag acggtagtgc cttactaaaa
   16951  gacaacaccg tcgttgaccg tttagaaggc ttgaatcctt tggcttattt
   17001  gttaaagtta gcgagaacga ctactactat ttgttttact atgtctaata
   17051  aggttctttt ttgtactact aaatccgaac cacttagttg tttagctgtc
   17101  acatcggatc gagttttatt caaagttatt atgggtacta acgttgatga
   17151  ttctcgatgc ggctgcagta tttggtttta cgacaatggg acgtttcaaa
   17201  acgggttgac ccgttgtaac aatctcgtcg ctttgtttag cgcgacttag
   17251  acacgaagtg accgttcggg tttaaatgct gcaatgagta ttcgacgcgt
   17301  gtggttaaag gttgtggccg tgattacggt attgtggtac ggtaaagagc
   17351  cttcgattag tgaaggttac aatgctctta tgaatgatga ctttaagttt
   17401  atcgatacgc atttttcaaa cgtttcttat gctaagaaat gttacgaatt
   17451  agctaacttc gatttagact ttctacgcat cgttatcatt cccttgagtg
   17501  gtggtacggc gaatgaatcg cgtgctgatc gcactaacat ttcagagata
   17551  gtcgaatcgc atatgagcga ccgagacaga atgagtatct tgttgcgtaa
   17601  taagcggatc cagattcctt cgctcttacc ttgcggtaac tagagtctac
   17651  tcagtagtac gtctactagt ataacgtatt gaacacttta gtgaggagtt
   17701  ttgtttaaac caaacaatat gcgagcttac tttagtgtta acgattacat
   17751  aagcctttcg gctaaggtcg gcgcagttgt ggaacgttta tgcgatccca
   17801  gcgtgactct cacggaagtg atggacgaaa ttaatgattt taactcgttt
   17851  ctcgctttag tacactctat gaagtcagac atgaacagtg atcatcagga
   17901  tggtcaccat gagatgggtg aacacaagtc tcgattgttg tgcaatatag
   17951  aggcgaaact gcgaatactt ctcgacatca taagacgtcg gtttactcgc
   18001  gacaagctgc tctgtaccag cgcaacagac gtcatgggct tcttcgttat
   18051  gagatacatg gcttctagtc acatcagttt tgaatccgta atgcgaacgg
   18101  agctgaaatt agtagttaaa gcagtactat cggatttatc ccgcgcgcat
   18151  aaactagatt ttagcgagcg agcctttgcg gcttacggta tccttttaca
   18201  aaagggtact gtagcgaccg tttgtggtca gtttgacatt aatttagttt
   18251  ctccatcttg cgtgtaggtt aatacatttc tcagaacgtg tgattgtatt
   18301  aactaacttt aattcgaaca aatttattat taaaagtctg tgagttacga
   18351  tggacgatac tagcggacaa actttcatct ccgtgaacct ttctgatgaa
   18401  agcaacacgg ctagtactga agttaaaacc gtaggttctg aagcggatcg
   18451  cttggaattt ttacggaaaa tgaatccctt tgttatcgat gctttgatac
   18501  ggaaaaccag ttatcagggt gctcgctttc gcgcgagaat aataggagtg
   18551  tgcgtggatt gtggtagaaa acacgaaaag gggtcgagga ctgaacgtaa
   18601  gtgtaaggtc aacaacacac agtctcagaa cgaggtggcg catatgttaa
   18651  tgcacgatcc cgttaagtat ttaagtaaaa ggaaagctag agccttttct
   18701  aacgcagaga tgtttgcgat cgatttggtt atgtacacca aagaaaggca
   18751  attagcggtt gatttggccg ctgaaaggga aaagacgaga ctggctcgta
   18801  aacacccaat gcgttctccg gaagaaactc cggaacatta taaattcggt
   18851  acgactgcta aagcaaagtt accggacgtc gacgtcgtag acgttggtga
   18901  caacgaagac acttcgtcgg aatacccaat aagtctgagt gtttctggcg
   18951  gagttctccg tgaacaccac ttcatctgat tgaagtggac ggaataagtt
   19001  ccttgcggaa ctttatgtcg ggttggtaaa aacccttatg atggtgatat
   19051  atcactagac aataaccgga tgggtaaagt ctttaaaatg atcgagggga
   19101  aagattaacc gtatcctctc gttggtctaa gctcccacag agtggtagtg
   19151  gtctcaagtg aggcttaacg tatgcgtgaa ccaaagaagt tctccttaga
   19201  gtgtgtgttg tttacccaac acactgtccc tatggggggc caacataggt
   19251  cca