Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate D5 p23 protein gene, complete cds.

ACC No: KC577594

Dated: 2013-03-19 | Length: 630 | CRC: 112287572

                
ID   KC577594; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   KC577594;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate D5 p23 protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Chandra V., Kumar A., Biswas K.K.;
RT   "Characterization of Citrus tristeza virus based on ORF11 (p23)";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Chandra V., Kumar A., Biswas K.K.;
RT   ;
RL   Submitted (04-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="D5"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Delhi"
FT                   /isolation_source="Citrus aurantifolia (Kagzi lime)"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Jan-2012"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /note="suppressor-like; ORF11"
FT                   /protein_id="AGH18402.1"
FT                   /translation="MDYTSGQTFISVNLSDESNTASTEIKAVSSEADRLEFLRKMNPFI
FT                   IDALIRKNNYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMLTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPDTNAVDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 192 A; 125 C; 158 G; 155 T; 0 other;

kc577594 Length: 630  19-MAR-2013  Type: N  Check: 8438  ..

       1  atggattata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagtactg aaatcaaagc cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata attatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaggt caacaatacg cagtctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgctcacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacac caacgctgta gacgttggtg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga