Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AG18 coat protein gene, complete cds.

ACC No: KC590494

Dated: 2013-03-19 | Length: 672 | CRC: -69036484

                
ID   KC590494; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590494;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AG18 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Tarafdar A., Khatun D.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Khatun D.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limon (Assam lemon)"
FT                   /isolate="AG18"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Jorhat, Assam"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Apr-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18409.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVAAAESSFGSLLLHIDPTLIAMNDV
FT                   CQLGTQHNAALNRDLFLTLKGKYPILPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTRDGVEVDLSDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADLVTGAGLTDLECAERRQAKEQLLKMRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 124 C; 175 G; 182 T; 0 other;

kc590494 Length: 672  19-MAR-2013  Type: N  Check: 6177  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgctgcag ctgagtcttc tttcggttcc ctattattac
     101  acatcgatcc gactctgata gcgatgaacg atgtgtgtca gttgggtacc
     151  caacacaatg ctgctttgaa cagagatttg tttcttacct tgaaagggaa
     201  gtatcctatc ttacctgaca aagacaaaga ctttcatata gctatgatgt
     251  tatatcgttt agcggttaag agttcatctt tacaaagcga cgatgacacc
     301  acgggtgtaa cgtacactcg ggacggtgtt gaagtggatt tgtctgacaa
     351  gctttggact gacgtagtgt ttaactctaa gggtattggt aaccgcgcta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaattt gagttatggt ggacgtccgt tagatgcggg
     501  aattccagcc gggtatcact acctgtgtgc agatttggtg accggagctg
     551  gcttgactga tttggaatgt gctgaaagaa ggcaagctaa agagcaatta
     601  ttaaagatgc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga