Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate MB6 coat protein gene, complete cds.

ACC No: KC590495

Dated: 2013-03-19 | Length: 672 | CRC: 2058126528

                
ID   KC590495; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590495;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate MB6 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Tarafdar A., Khatun D.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Khatun D.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus limon (Assam lemon)"
FT                   /isolate="MB6"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Barapani, Meghalaya"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Apr-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18410.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKAKYPNLSDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRANALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVFTNVRQLGKFHT
FT                   R"
XX
SQ   Sequence 672 BP; 188 A; 125 C; 176 G; 183 T; 0 other;

kc590495 Length: 672  19-MAR-2013  Type: N  Check: 4574  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttct gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaatg ccgctttgaa cagagacttg tttcttactt tgaaagcgaa
     201  gtatcctaat ttgtctgata aagataagga ctttcacata gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga tgacgacact
     301  acgggtataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtgcta
     401  acgcccttcg agtctggggt aggactaacg atgcccttta tttagccttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagagtgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta tttaccaatg tcaggcagct
     651  tgggaaattc cacacacgtt ga