Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate AG26 coat protein gene, complete cds.

ACC No: KC590497

Dated: 2013-03-19 | Length: 672 | CRC: 321958941

                
ID   KC590497; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   KC590497;
XX
DT   19-MAR-2013 (Rel. 116, Created)
DT   19-MAR-2013 (Rel. 116, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate AG26 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Biswas K.K., Khatun D., Tarafdar A.;
RT   "Characterization of Citrus tristeza virus and determination of genetic
RT   variability in Northeast and South India";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Khatun D., Tarafdar A.;
RT   ;
RL   Submitted (08-FEB-2013) to the INSDC.
RL   Advanced Centre for Plant Virology, Division of Plant Pathology, Indian
RL   Agricultural Research Institute, Pusa Campus, New Delhi, Delhi 110012,
RL   India
XX
CC   ##Assembly-Data-START##
CC   Sequencing Technology :: Sanger dideoxy sequencing
CC   ##Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus reticulata (Khasi mandarin)"
FT                   /isolate="AG26"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Dumduma, Tinsukia, Assam"
FT                   /collected_by="K K Biswas"
FT                   /collection_date="Apr-2010"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF7"
FT                   /protein_id="AGH18412.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDIVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRYLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 201 A; 124 C; 166 G; 181 T; 0 other;

kc590497 Length: 672  19-MAR-2013  Type: N  Check: 3045  ..

       1  atggacgacg aaacaaagaa actgaagaac aaaaacaagg aaacgaaaga
      51  aggtgacgat gttgttgcag ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacaaaatg ctgctttgaa tagagatctg tttcttactt tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggaac tgtccgacaa
     351  actttggaca gacatcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttagctttt
     451  tgtagacaga accgctactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcagtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga